SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000015064 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000015064
Domain Number 1 Region: 10-30
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000164
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000015064   Gene: ENSTRUG00000006187   Transcript: ENSTRUT00000015133
Sequence length 37
Comment pep:novel scaffold:FUGU4:scaffold_298:208672:208782:-1 gene:ENSTRUG00000006187 transcript:ENSTRUT00000015133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGSQKRAAGALSCYNCGSGGHKAEACKQPAMEPAQQG
Download sequence
Identical sequences H2SRM7
ENSTRUP00000015064 ENSTRUP00000015064 31033.ENSTRUP00000015064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]