SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020712 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020712
Domain Number 1 Region: 411-798
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.35e-130
Family Ankyrin repeat 0.000000000403
Further Details:      
 
Domain Number 2 Region: 166-426
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-71
Family Ankyrin repeat 0.00000374
Further Details:      
 
Domain Number 3 Region: 8-201
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.64e-49
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 4 Region: 1477-1588
Classification Level Classification E-value
Superfamily DEATH domain 1.47e-28
Family DEATH domain, DD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020712   Gene: ENSTRUG00000008279   Transcript: ENSTRUT00000020798
Sequence length 1869
Comment pep:known_by_projection scaffold:FUGU4:scaffold_164:209356:245424:-1 gene:ENSTRUG00000008279 transcript:ENSTRUT00000020798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSVCLLQSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHIELVQ
ELLDRGAPVDSATKKGNTALHISSLAGQVEVVKVLVKRGADINAQSQNGFTPLYMAAQEN
HLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEHDTKGKVRLPALHIAAR
KDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF
TARNGITPLHVASKRGNTNMVGLLLDRGSQIDAKTRDGLTPLHCAARSGHDTSVELLLER
GAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVT
KLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFM
GHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPL
HIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATK
KGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDHQKVALLLLDKGAS
PHTMAKNGYTPLHIAAKKNQMDIATVLLQYGAETNIVTKQGVTPLHLASQEGHADMAALL
VGKGAQVTVQTKSGLTPIHLAAQEDKVGVAEILAKSGANLDQQTKLGYTPLIVACHYGNA
KMVNFLLQNGAVVNAKTKNGYTPLHQAAQQGNTHIINVLLQNGAKPNAMTVNGNTALGIA
RRLGYISVVDTLRVVTEEIITTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEY
LRAEDLRELGDDSLPGQYLDGMNYLRFSLEGGRTDRLVSSSTDRSFTPTHHSYYSPKHDG
MMEEMLTSQQVSSLARDNERDSYHLSWATDNLDNVALSSSPLHSGRSSPCQDHGDHSSFL
VSFMVDARGGAMRGCRHNGLRIIVPPKKCSAPTRVTCRLVKRHRLATMPPMVEGEGLASR
LIEVGPSGAQFLGKLHLPSAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRG
KERELVILRSETGESWKEHHCEHTQEELNLILNGMDEALDTPEELERKRVCRIITRDFPQ
FFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPVGVEVVRKI
LGNKATFSPIVTLEPRRRKFHKPITMTIPVPKSNQDPTLTGFGGDTPTLRLLCSITGGTT
PAQWEDITGTTPLTFINDCVSFTTNVSARFWLIDCRQTQESVNFSSQVYREIICVPYMAK
FVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFSEVARSRDVEVLEGKPIYADCFGNL
VPLTKSGQHHLFSFFAFKENRLALFIKIRDNAQDPCGRLSFMKEPRNYRSLTQNAICNLN
ITLPSYCKKESDSDQEQEEETSQMTSSVDPQDEAERKEQHLAIIADHLGFSWTELARRLD
FGEEKINLIRNENPNSLQDQSHALLKLWAEREGAGGTEEALIKTLTKINRMDIVHLIETK
IIKSNVEETSSCTYAEIEQTIALDHSEGFSALHEDIDSPRPSRRTELKHNSGSGREVPVV
LSEDLSTSLSSLHDTLGRFGTDSSPTGPFKFPQSQKGMEPSYLKARVQTAPIESVVPDSN
QNFVTTRGAAKSWSKECLIDSQGPSQSSESAAADQEDLDVHPETRPSSPDSISESGPLPP
ESPVPQFESHLPEFAAWIAREALSSPISDCSESADVESQFVKADNLPDLPPQTVTEEKYT
DEHGNMVVKKITRKVIHKYVSADGTQTQEVSMEGSQQEPVPIQEGDTVSRVIKRTVLRSE
GDQKEVGGS
Download sequence
Identical sequences H2T7S2
ENSTRUP00000020712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]