SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020714 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020714
Domain Number 1 Region: 417-804
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.87e-130
Family Ankyrin repeat 0.000000000403
Further Details:      
 
Domain Number 2 Region: 179-432
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-74
Family Ankyrin repeat 0.0000032
Further Details:      
 
Domain Number 3 Region: 28-245
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.68e-59
Family Ankyrin repeat 0.0000167
Further Details:      
 
Domain Number 4 Region: 1427-1523
Classification Level Classification E-value
Superfamily DEATH domain 7.36e-27
Family DEATH domain, DD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020714   Gene: ENSTRUG00000008279   Transcript: ENSTRUT00000020800
Sequence length 1771
Comment pep:known_by_projection scaffold:FUGU4:scaffold_164:209509:245466:-1 gene:ENSTRUG00000008279 transcript:ENSTRUT00000020800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQNRSDRRRRAANHSVCLLQSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNA
LHLAAKEGHIELVQELLDRGAPVDSATKKGNTALHISSLAGQVEVVKVLVKRGADINAQS
QNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEHDT
KGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNR
GAAVDFTARNGITPLHVASKRGNTNMVGLLLDRGSQIDAKTRDGLTPLHCAARSGHDTSV
ELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHC
GHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPI
HVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAR
EDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGAS
HSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDHQKVALLL
LDKGASPHTMAKNGYTPLHIAAKKNQMDIATVLLQYGAETNIVTKQGVTPLHLASQEGHA
DMAALLVGKGAQVTVQTKSGLTPIHLAAQEDKVGVAEILAKSGANLDQQTKLGYTPLIVA
CHYGNAKMVNFLLQNGAVVNAKTKNGYTPLHQAAQQGNTHIINVLLQNGAKPNAMTVNGN
TALGIARRLGYISVVDTLRVVTEEIITTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMT
GDGGEYLRAEDLRELGDDSLPGQYLDGMNYLRFSLEGGRTDSTDRSFTPTHHSYYSPKHD
GMMEEMLTSQQVSSLARDNERDSYHLSWATDNLDNVALSSSPLHSGFLVSFMVDARGGAM
RGCRHNGLRIIVPPKKCSAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFL
GPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEHTQEELNLILNGMDEALDTPEEL
ERKRVCRIITRDFPQFFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRV
GLQAQPVGVEVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKSNQDPTLTGFGGD
TPTLRLLCSITGGTTPAQWEDITGTTPLTFINDCVSFTTNVSARFWLIDCRQTQESVNFS
SQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFSEVARSRDVE
VLEGKPIYADCFGNLVPLTKSGQHHLFSFFAFKENRLALFIKIRDNAQDPCGRLSFMKEP
RNYRSLTQNAICNLNITLPSYCKSPIVSLIQLWSSSSVDPQDEAERKEQHLAIIADHLGF
SWTELARRLDFGEEKINLIRNENPNSLQDQSHALLKLWAEREGAGGTEEALIKTLTKINR
MDIVHLIETKIIKSNVEETSSCTSSQRVYEEVTDRGGFEQVSSSGTLNPASPSSITSQLV
SPGDSDNEDAPMGPKEIIKAETNEEEAKGAAATTVENIESSTKDQRSSSSRNRSSPKSGG
SDIEYGCMKLEVKERPLTPYSVSEDKATSLVLMSNLRSSSPDDLETDLCMPWLFEDRASS
ADSAGSNDEMKPLSPDSPIPEFTQEIAEELGALSSDSSEEEVLTTRVVRRRVIIQADNLP
DLPPQTVTEEKYTDEHGNMVVKKITRKVIHK
Download sequence
Identical sequences H2T7S4
ENSTRUP00000020714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]