SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000022905 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000022905
Domain Number 1 Region: 402-791
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.79e-128
Family Ankyrin repeat 0.000000000436
Further Details:      
 
Domain Number 2 Region: 165-420
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-75
Family Ankyrin repeat 0.00000262
Further Details:      
 
Domain Number 3 Region: 15-243
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.66e-60
Family Ankyrin repeat 0.0000157
Further Details:      
 
Domain Number 4 Region: 3829-3943
Classification Level Classification E-value
Superfamily DEATH domain 3.53e-25
Family DEATH domain, DD 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000022905   Gene: ENSTRUG00000009110   Transcript: ENSTRUT00000023000
Sequence length 4008
Comment pep:known_by_projection scaffold:FUGU4:scaffold_121:412501:455606:-1 gene:ENSTRUG00000009110 transcript:ENSTRUT00000023000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQQKKKSDSNASYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAE
LLKLEATVDAATKKGNTALHIASLAGQSEVVKELVNNGANINAQSQNGFTPLYMAAQENH
LEVVRFLLENGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARK
DDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPL
HVASKRGNSNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEILLDRGAPFLSKTK
NGLSPLHMATQGDHLNCVQLLLRHDVPVDDVTNDYLTALHVAAHCGHYKVAKLLLDKKAN
PNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHAL
THHGASPNTTNVRGETALHMAARAGQADVVRYLLKNGAKVETKSKDDQTALHISSRLGKV
DIVQQLLQCGASANAATTSGYTPLHLAAREGHQDVAVMLLENGASLSSSTKKGFSPLHVA
AKYGKMEVASLLLHKRAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSAAKNGY
TPLHIAAKKNQMDIGTTLLEYGADINAVTRQGISPIHLAAQDGSVDLVSLLLAKNANVNV
CNKSGLTPLHLAAQEDKINVAEVLLNHGADVNPQTKMGYTPIHVACHYGNAKMANFLIQN
HARINGKTKNGYTPLHQAAQQGHTHIVNLLLQHSASANELTVNGNTALSIACRLGYISVV
DTLRVVTDESLAAMSTSEKHKINVPETMNEYLDMSDDEDRFLKDSFYIFDSGYMILHTSP
GDDAMTGDTDKYLRPQDLKELGDDSLPQEGYMGFSIGARSASLRSFSSDRSNTLNRSSFA
RDSMMIEEILAPTKDTHLAVTRDYNSECMRRYSWTPDTVDHSHNTMSSPIHSGFLVSFMV
DARGGSMRGSRHTGMRIIIPPRKCTAPTRITCRLAKRHKLAYPPPMVEGEGLVSRLIEVG
PAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWREHQFDIRVEDLTELLAGMDEE
LDSPVELEKKRICRIVTTDFPQYFAVVSRIKQDSNHMGPDGGMLSSSTVPMVQASFPQGA
LTKKIRVGLQAQPVPDELVRAILGNRATFSPIVTVEPRRRKFHKPITMTIPVPPRSAEGH
PSGQRGDCAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTECVSFTTNVSARFWLADCHQ
IPETVSLASQLYRELICVPYLAKFVVFAKMNDVVEARLRCFCMTDDKVDKTLEQQENFEE
VARSKDIEVLEGKPIHVDCYGNLSPLTKSGQQLVFNFYSFKENRLPFNVKIRDMGQEPCG
RISFLREPKTTKGVPPTAVCNLNITLPTHKKDMESDPDDETEKPERRHTFASLALRKRYS
YLTDPAAKTTDRSSPRTQPSSYPHKPVFSTRSYQAWTPVPVSIPGQAKSGFGSLSSSSSN
TPSASPLKSVWSINSASPIKTNVPGSPASSVKSISDMASPIRSYRTISSPIKTVVQQVQY
PVQIAPSPLASPGKNVPDLLSTKGLTTLSARTSPITTSGGSSPLLDRGMTPPASPKSSLT
MFSSPLPYKTAMTGSSGTSSTIKTVPGLSSVRSFALDAINPARTFFSSLSSPLKINTSPS
AAALINGTVSPSQYRSSSPTSLLTSSLQERIQATTNAATTNVSAAFDEVEKTFNSCSAGY
GTLKSMSSSASSSYQSIRSSASNSLYASFRSPPSATTAVTSSTVTVPVYSVINVMPEPQF
KKLPEVSKSAAALLSPRKTVAPEVNAQLQSSFARTLSPIKAPLFSAGLKSSTTSPLSSSQ
EILKDVADMKEDLIRMSAILQTDPNSTANKGFQSDSPKEAKIEDEEPYRIVEKVKHDLVK
VSEILTKEAVKDGKSSMARDSLDDIHFSKMQVEQPPSNWSYPPRYETVVHQAKSKTIPDQ
DFNLSKVVDYLVNDVGSSSFSKIHEAKHQVDEVKKDVEGKEKQKRVLKPTIAVQENKLKM
PPSNMRSSVSDKEPSKGTDVLFGADTVLESPDDISHEQDKSPLSDSGFETRSERTPSAPQ
SAEGMGPKALFQDIPVPPVITETRTEVVHVIRSYEPTEDNKKAAMDSPQSVRYTNSDSRG
CQNQATPTPEQSKCFSVKVSPDEDSKGTGMRVKEETHITTTTRMVYHNPPGKDMTSERCD
ETMSVHDIMKAFQSGKDPSRELVGLFEHKSANEETSQRVFEDIHSRPKVERIIEVHIEKG
NKTEPTEVIIRETKNHGEKEMYYYPSNRLEEEDIEEPLPGYLDSPRVNTPMSQEDDSRPN
SAQLVSDDSYKKLKMLSQQSVEYNEDESSELRGESYNFAEKMLLSEKIDQSHSDTEDYLS
DRSRFRSPDRSSHSEGRSVGPRTEYVFRSSRNVFDKSGRMANVDNNFDKLTQLQYPPEPG
NPKQSVWMHVSDDGQNVREQLAYEDRVDRTVKEAEEKLSEVSQFFRDKTEQLNDELSSPE
KKSRRSDFRESRSRPSSTHSSPERSSYRNGGSGEEWSRERLRDRFTSSERKCASLPSSPE
RRVILQYTDAISKNHGDSKSQEYTRDNPKPVQMSTSKVSAVRLKFEQEAQRHEPKNSQGG
QNLNPPVRKLQETKLPAYQVFAGSDIPKAPDTLIGHRKCSENQSVNLPCKFQGSGKGQEE
KGLFKNSESQHYGTYKPQSAKLSHSEIHNSMKNSKSSNSPRQETTKKIIYTEYVVRESST
RSDSLKKNSESQIPVRKPSEFSENQKSAPFKLDACVDPVQSTGSHIPMLTRTRLHSVSDS
NNSIHDTPKSIDNSRTNIVCNGVDGDQVEYLEQGNPVAITEGFKVIKPLPVYVSIQVGKQ
YEKETGSGQLGTYKKIVSHESRTVHESRGTFYTMKQKQSSSPQGSPEDDTLEQVTFMDCS
GKSPVTPETPSSEEPSLTSRTPDSVIGPMPGMPCTIPEESEEEERKSSMYKDALKEKIKS
ALSENIIKTVDAERQMAMEKGVAYIEFPPPPPLESEQSHLEKRCSCTSSEAETEMMEVNL
QEEHDRHLLAEPIIRVQPPSPLPPGADNSDSSDDESVFHPIPVKKYTFKMKEEGEKHMKH
KKTEKNGNKDHGIEGVVKGDDADSDQNGNDQSITDCSIATTAEFSHDTDATEIDSLDGYD
LQDEDDGLSEDHKTSSLSNDGKTSDRTFSQSKLEVIEEEKCEEMGNNGKTKTTTSTVKSS
GDERDYTLEGRHPDRQGIGENCFGYQLEKELNSTFKTVATKGLDFDPWSSKGGENEGVFE
SKTKEEDPKTFGLSVEDKSQATTPDTTPARTPTDESTPTSEPNPFPFHEGKMFEMTRSGA
IDMSKRDFVEERLQFFQIGEHSSDPKTGEKGKGGKSLGINSQSKPEESFTVDGMLKLIDT
TIDNSTTPTTTAATCSPAESGTDTHTVTEAPTCEAVVETASSCTITASKVDPKLRTPIKM
GIAASITVKKETGELSCCKADMSEGHLVPEYISIESHCSESQSSKYTDLKLGGRDYPAEN
CNNNNNLESSSVQANYIQCGSVVFNLQSSSEPTLQKASRIETLCCDVTEEKSEVKHRPLL
SESKSETVKEGEVKQPKSRLPVKASGWSFHTQGTAVGKQKPKQAVTVEIRKRREPAIAKV
EPRSRIPIKDIKKSGSGATGSSLVSNQVSALPTRVLDIKLPLRQAVKERNQVCNVTFGGV
AKQHTQENPSEVCKHTIEYFKGISGETQKLVDRLSDEEKKVQTEQSEEDSTSRSTSLSDA
SQPSQPSRSSRSGRGLRAEAGAASVRTKVATTDRASGSERSRRSRRTGPQSPCERTDLRM
AIVADHLGLSWTELAREMNFTVDEINQIRLENPNSLTAQSFMLLRKWVSREGKNATTDAL
TTVLAKVNRMDIVTLLEGPIFDYGNVSGTRCFADDSSVFRDQADGWHSDSSSVNVEPPTP
GRSVSSDLLDRRESPNSQENSSDSITSSSRGESRKSRRNGNGSKHSPQ
Download sequence
Identical sequences H2TE13
31033.ENSTRUP00000022905 ENSTRUP00000022905 ENSTRUP00000022905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]