SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026160 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026160
Domain Number 1 Region: 1533-1782
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000177
Family Tropomyosin 0.00049
Further Details:      
 
Domain Number 2 Region: 1391-1563
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000719
Family Tropomyosin 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000026160
Domain Number - Region: 1098-1313
Classification Level Classification E-value
Superfamily Tropomyosin 0.00301
Family Tropomyosin 0.0041
Further Details:      
 
Domain Number - Region: 1773-1883
Classification Level Classification E-value
Superfamily Tropomyosin 0.0458
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026160   Gene: ENSTRUG00000010390   Transcript: ENSTRUT00000026267
Sequence length 1905
Comment pep:known_by_projection scaffold:FUGU4:scaffold_87:371304:383074:-1 gene:ENSTRUG00000010390 transcript:ENSTRUT00000026267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKKLTVRGPSPDAPPACLPARVREIVTKNLSESRELPQSLAAGAMSSVMSLQEENRVLQG
ELARLEDLLAHSRADRDELAIKYSAISERDEQSSNLEDALIRLEEEQQRSSSLSAVNAML
REQLEQAGIANEALSQDIRRLTTDWTKAREELEQKESDWRREEESFHSYFSSEHSRLLML
WRQVVGFRRNVCELKNGTERDLSDMRNELARTCHSVQVSCSSLSSVLHSREGGAVLALER
EKSLRLQLEQQLRERVGEMMNFQTKADAEKSGLSLRLSDLLRESERLKGQIEERDTEIAV
LMRKLKEQSVNDETDMQMMKTHTESLLDTLRDIAQVSCNTNMLAVRGRGLLQEGDSSSEA
DQENSGTPLLALFHSSSTRRSTSPSRSSSQALLTDSALCALRSAVTNKTLQLQDVRGRLI
SSQSSIQQLRKQLSESDLAKREAEQRIQSLQRERDAAQREKETTLKEKERLKEDRDVLAS
EKVSLEKVVQAAQGSSQLLEMESKKLQLIVASAQRERDHEREQKEAAVLERDRAKAETQR
IQKQLEQSESRLSSQRGELSAVRETHQKGEVERQVLEGERAQLSEALARAESRNAELSLL
LNKLQSEEAALRDSLAKVGSLNESLAQDKADLNTYILQLEEEKSVLQAQKREAQQQKLTI
RDELRLEQDRLELDAARITLQHSLQDVELSQVGVDAELQSLREEKVKLQERVTQLCSEVS
SLGSELSLAKGEGQRSEVALEEAGRSRAELARDKAALVVQLTASEKENTALSEELAAFRS
ERESLETSLFEMQQQLVQAESRREQLEAENQNLRLRSETAAVELRRLRSDGENVLAQAER
EKQALTQTLNAAQLEAQQALHKAVSEHQEEVERLVSEKEALRDSLLMEQESALRKLRQEM
EEPLHRAEREREELQEELRSLQHDRDQSLLQAETEKQQALSLKETEKAVLSDRVSCLQAE
LTAAALEAERMSREAALYKEQEQIRVAALNSELQALRSQLEDASSLHERELQSAREACTD
LQSHTDVALKELDQCRAALAANEETRDQLKRDVTDAERRQNQTVDTLETCRREVSELRRN
LADITHEKDTLSHSNILLRETVRSAESERISVKRQHEEKEQKLSVLEESFASVQKEVTEL
RGCLREVERSRLEARRELQELRRKLKVLDGEKEQKEREVAELQTRLLLEEQREEEKAKEL
FAVRHKLTEAETARDFLKKELSMTQKRLVESESSWRSGERELSAQLQEARGCEKKLQDEA
KNLALRTQAAQDSAAQSGLLLSETQGRLAATEAELIRAEAGKKDLEFRLNSIQSALTRTL
GIGASGRRGRGRSPGGSSTSPGTISRHQSISPLRTSLSPPKEIQVCTPDTTLNSGAASPE
RGEAPLPLPQPELDPDALRSDLRDFMQELRETQRERDDAKCRVGLLERELEEMLGDQDST
QSRLTHLQKAFQEYQEGKRGLEERLSTTQILLQQQEEAVRRADRDRRAVTDRLRDLERAL
QVSETDKKNMQDQLNKQRAAEMRLDSERRRLREALEAAEARATRVELGRRSLEGELQRLK
LSLGDRETESQNSQERYDSLMKQLSEGEARTSLLQRETERLSHSLLKSQEDESILKEKIS
SLRKSLQEAAASHSSHQSRLAALQKMLTEVEHDKRLLQEQLEEARVSAAEGKRSSASISE
RIQSLQGELSHSERRREELEAELRSTQELLQQRTASLTEAQRSAQSAQVERATVEERLRG
LQRAVAMLETEKKDAERQAVRLEKDKNALRNTLDKVERQKLMTEESSMRLSAAKGRLDRS
LNTAEQELQEAQQQILMLQTQLADLEQSHGLCESLVRQREEAQREAERLRSSFREAEQTL
GARERAHRHRVKGLEEQVSTLKEQLLQEMKRRQPSLPSPLMPAGN
Download sequence
Identical sequences H2TNA4
ENSTRUP00000026160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]