SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028007 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028007
Domain Number 1 Region: 199-290
Classification Level Classification E-value
Superfamily TAFH domain-like 1.01e-30
Family TAFH domain-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 475-523
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000251
Family TBP-associated factors, TAFs 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028007   Gene: ENSTRUG00000011095   Transcript: ENSTRUT00000028117
Sequence length 671
Comment pep:known_by_projection scaffold:FUGU4:scaffold_67:552923:560345:1 gene:ENSTRUG00000011095 transcript:ENSTRUT00000028117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTVEAQPPSAAAGSAPGLQTTSPSIVVISKAAPPAASTKGQPQITKAVVSQALALTPQM
PQSTSSHQANLQIPPGMILIRSESGQLMLVSQQALTQTQRGPSSVSGQMSRVLGQQVSAA
VANKGGEQMTVLRMALPASSTFQSTAVQKSAVVKVPGYVQVVGVASKAATQSEGAVSSQG
NLPPLQTTETAKEPAATFSPETLESVKKCKNFLVTLIKLASSDSQAASMASNVRGLVRAL
LEGKIEAEQFTERLYQELKSTPQPCLVPFLKKSLPAVRHLTVDPHLFIQQASAFTPTTTN
SPSPTILLLYVTNSVMKVCPPVAVSILLEIRKITFSVGNHDEIKVVDYILKMCLLVQQPG
GEAVKPRPTLPLLGNSTATSVRMYTAISMFGSKTNELIPKISPGCFQGTFPMKLPLRQDA
SQMTTPAFRDGFGTYREDDDINDVASMAGVNLGEENAQILTSMVGSVVQSCHDQLFLSPN
LLLSQILHLGRPLGVTDVSPDVVALISHATQERLHGLVLRLTVLAGHRKAAVKEGPWHTK
VSDVRSQLRFLEEVETLKKKRNDEEERERLLLLARSRSHSEDPQHQQLKQRAKELQQIEE
AQMQKREANLTALAAIGPRRKRPLEQPESQVAVLPRPGLQRGTRITLRDLLLCMELDPFL
CHSLLLYKAML
Download sequence
Identical sequences H2TTJ9
ENSTRUP00000028007 31033.ENSTRUP00000028007 ENSTRUP00000028007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]