SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000029011 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000029011
Domain Number 1 Region: 163-254
Classification Level Classification E-value
Superfamily TAFH domain-like 1.44e-32
Family TAFH domain-like 0.00000798
Further Details:      
 
Domain Number 2 Region: 428-476
Classification Level Classification E-value
Superfamily Histone-fold 8.58e-17
Family TBP-associated factors, TAFs 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000029011   Gene: ENSTRUG00000011488   Transcript: ENSTRUT00000029127
Sequence length 643
Comment pep:known_by_projection scaffold:FUGU4:scaffold_33:742151:746697:1 gene:ENSTRUG00000011488 transcript:ENSTRUT00000029127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RALTPQALAPRLPHTSPGQPSVHNIQIPPGMVLVQSESGQLLMIPQQALAQVQAQAQAQA
QAQGGGAPRTATPTNVSPVQVSSSQAPGGTVISKPVAPTIIHQGCPAPTSLPATTTLHRP
PVLQMFYYLNISTKLTAMLCHDRAQSGPQERSPGPSTKQLGPQETIENVKKCKNFLSTLM
KLASTGKQSPETAALVRELVKDLLDGKLEAEEFTGRLYKELNSSPQPYLVPFLMRSLPAL
RQLTPDSTAFIQQSQLPQPSSAPVTSASPISSTVVLGSPAPRLPVPVNRPQFQPGVTKLG
QTTSLVVLQPQQQRAVLRPQVPLATTPMVTLRNPAPAHMVLGQQRVQLKDLQPGPVRPLA
SKQVSATALTPAQKNQLKEAGGTFKDDDDINDVASMAGVNLSEESANILATNSELVGVVT
HSCKDEAFLSTSLLQRRILEIGRKYGVTDLGAEVVKYVSHATQQRLQNLLEKVSLVAQQR
HISFKEDDNYEQGSDVRAQLKFFEQLDQLEKQRKEEQEREILLKAAKSRSRQEDPEQLRL
KQKAKEMQQQELAQLRQREANLTALAAIGPRKKRKFLDSPSSSSGAEGSGTCPSLSSGAG
TSGSRPTRQRITRVNLRDLLFCLENERFTSRSHFLYKSFLKTG
Download sequence
Identical sequences H2TWF2
ENSTRUP00000029011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]