SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000029215 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000029215
Domain Number 1 Region: 395-449,487-611
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000062
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 570-703
Classification Level Classification E-value
Superfamily EF-hand 0.000000206
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000029215   Gene: ENSTRUG00000011563   Transcript: ENSTRUT00000029331
Sequence length 886
Comment pep:known_by_projection scaffold:FUGU4:scaffold_17:920047:925286:1 gene:ENSTRUG00000011563 transcript:ENSTRUT00000029331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLESGEGIEMENIRHQDLGLGGVIGTPSPPSRQAWSRDNPGFEHEDGIMEADWPPASPGR
RSASTASGSSCSSGLGSFTGGGGGGGTHAPRGGLYPTPTVDTQQQESHQRRSCMKQILQK
IRILWGTELMEDRDSSRERYLRNILREMITYIAFLVTICILTYGMVSANMYYYTKVMSQL
FLDTPLSPGDPATFRSLATMEEFWKFTEGPFLNGMYWEVWYNNKSLPENQSLIYYENLLL
GVPRLRQVKVRNESCSIHQDLKGEVLECYNLYTPSNEDTASFGPKNGTAWVYASETEVNG
SSYWGQVSKYGGGGYYQDLSRTKEESMTKLQLLREHLWLDRGTRAVFLDFSVYNGNINLF
CIVRLLVEFPATGGVLTSWQFQTVRLIRYMSSWDYFVGLCEVAFSLFILYYIVEEVLEIR
IHRLHYFRSLWNCLDVLIIVLSVIAIIMNITRTAMVGKLLKGLLENHTAHPSFGSLAHLQ
VQFNNVAAIIVFFSWVKLFKFINLNKTMSQLTTTMSRCAKDLVGFAIMFFIIFLAYAQLA
YLVFGTQVDDFSTFQASIFTQFRIILGDFEFSEIEEANPVLGPIYFTTFVFFIFFILMNM
FLAIINDTYSEVKADMSQQRSEMEMTDFIKKGCNKALMKLRLKKTAVDDITDSLRQAGGK
LNLDELRQDLKGKGHTDAEIQAIFAKYDQEGDQELTEHEHQQMRDDLEKEREDLELERNS
LTRPISGRSFPRTQEDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGS
IVSKIDAVIVKLEAMERAKVKRRDVLGRLLDGVMEDERLGRDTDAHREQMERLVREELER
WECDDMGSQVSHPQPATPVGPRPRPSSSMSTDGLDTVTNGSSHVHL
Download sequence
Identical sequences H2TX06
ENSTRUP00000029215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]