SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040156 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040156
Domain Number 1 Region: 2-563
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.88e-84
Family Acetyl-CoA synthetase-like 0.0000108
Further Details:      
 
Domain Number 2 Region: 705-1054
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.75e-41
Family Quinoprotein alcohol dehydrogenase-like 0.0087
Further Details:      
 
Domain Number 3 Region: 554-601
Classification Level Classification E-value
Superfamily ACP-like 0.0000327
Family Peptidyl carrier domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040156   Gene: ENSTRUG00000015712   Transcript: ENSTRUT00000040298
Sequence length 1057
Comment pep:known_by_projection scaffold:FUGU4:scaffold_13:1645075:1651604:-1 gene:ENSTRUG00000015712 transcript:ENSTRUT00000040298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTLQELVVAAASVHSDRVAVIYDDGSASACPVTVFYSDLVQLSSELSRILRKNCSSNCGV
IGLYCNDDLFIPVWILGILASPAAYVPLDPEAPGLLSARVMNQCGLKYCAVKTDLLQFVK
PMLTQVLNSDTDTVFDNNLLFYHLHISLSFPPLLQRFQASLVDHMSVEAADGAGGSVAAK
RLIEEGRRDLAYVLHTSGTTGRPKIVRVPHKCILPNIVHLRSLFQVTADDVVFLASPLTF
DPSVVDMFLALSSGARLLVVPSVFKKRPGQLARLLFRRHNTTVMQVTPTLLLRFGHHILK
EEVLSSASSLRVLALGGEACPPPALLRSWRDEHNKTSIYNIYGITEVSCWACCHKIPESV
LQSTEHTESFVPLGAPLMDTIVEVRDDQGGVVTEGEGQVFIGGEERVCLLDKEEAIGPGT
MRATGDWVNVNSERLQYLGRRDRLIKRHGKRVNLDSVQQLMLRLPQVEACAVALQEGFRL
LAFVVPSRNQPVQQLVLNQLSLLLPSYSVPDALLLVPALPLTPHGKVDMGALVKRYQGQR
KRLGMCPSSSDDSKLRQTVQFLWQEALGLPKDVTIDEDSNFLLSGGDSLKALRLHEDILA
AAGEASPELLEIILDGTFSDVLSHVTRTAQTATPGNRPLSPSGVAKRHTDLPNAAPTKRE
RKESKAAEETWAVKVLRRAGEVVDINIPETSVPDDALKQKSSEKDVLDLSLSWSSDTGRC
VDASPVLLLRYRTDQCPAEGKTTVIIGSHSHRIQALDLISGSLVWERVLGGRIEASAAVS
RCGSLVVVGCYDGCVYFLCTVTGETRWIFKTGDAVKSSPAVDPVTGLVIVGSHDGTIYGL
NPEVEQCVWRRHCGGGAVYSSPYLQTSLRQLYVASLGGHLLCLNPESGEVLWSHSRDVPF
FSSPNGATGHVLIGSVDGNICCLNSAGKPMWEFLTNGPVFSSPCVTPDLRQVLCGSHDGS
LYCLNCADGSLAWSFRTTGKVFSSPCVFDGSAAGRWGTLVGLASTDGTVWVLDGRDGRML
ASLTLTGELFSSPVVWGRSLVVGCRNDFVYCLNLTVK
Download sequence
Identical sequences H2UT83
ENSTRUP00000040156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]