SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044450 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044450
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-53
Family YWTD domain 0.00000301
Further Details:      
 
Domain Number 2 Region: 624-886
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-52
Family YWTD domain 0.00000394
Further Details:      
 
Domain Number 3 Region: 323-561
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-51
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 4 Region: 933-1187
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-38
Family YWTD domain 0.0000751
Further Details:      
 
Domain Number 5 Region: 1240-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 6 Region: 1281-1316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 889-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 580-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1318-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 10 Region: 277-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1197-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044450   Gene: ENSTRUG00000017350   Transcript: ENSTRUT00000044600
Sequence length 1474
Comment pep:known_by_projection scaffold:FUGU4:scaffold_430:45780:58645:-1 gene:ENSTRUG00000017350 transcript:ENSTRUT00000044600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSFLAALPLLLFANRRDVRLVDAEGARGESAVVVSDLVDAAAVDFLYTEGIIFWTDVSEE
AIKQTYWNLSSNYALGTGQTVVVSGLASADGLACDWLGKKLYWTDSETNRIEVSNLDGTS
RKVLFWMDLDQPRALALNPAQRYMYWTDWGEKPRIESAGMDGSNRKVLVNQNIYWPNGLT
IDLLEHKLYWADAKLSFIHRANLDGSAREAVVEGILTHPFALTLSGETLYWTDWQTRSIH
ACNKQKGDNIREILSGIFSPMDIQVLDPSRQPYLQTPCGDNNGNCSHLCLLSPVEPFYSC
ACPTGVQLKPDGKTCKPGAEHVLLLARRTDLRKISLDLPDFSDIVLMVDDIRHAIAIDYD
PVEGFVYWTDDEIKAIRRAHIDGNTSAMLVATELKHPDGIAVDWVARNLYWTDTGTDRIE
VTRLNGTSRKILISENIDEPRAIVLDPVNGYMYWTDWGQQPKIERANLDGTDRVVLVDSN
LGWPNGLALDYSTGKLYWGDAKTDKIEVIDVDGTNRQTLLDDNLPHLFGFTLLGDFIYWT
DWQMRSIERVHKVTAARETIIDQLPDLMGLKATNVTETHGTNDCALNNGGCSHLCFWCQR
AVRCACPMGMELLSDLHTCVVPEAFLLFTNRDSIRSISLGTHGNDVAIPLTGVKEVSALD
FDVSERRIYWTDIQAKTITRAYMNGSSVEHVIEYGLDYPEGMAVDWMGRNIYWADTGTNR
IEVARLDGRYRQVLVCKDLDNLRSLDNPRSLALDPASGYMYWTEWGGRPRIARAYMDGKT
TTTLVDEVGRANGLTIDYVAHRLYWTDLDTSMIESTNMQGLQRQTIVEELSHPFGLTQYQ
DFIYWTDFNLRSIERADKRTGLNRTVVLQGQLELMLDILVFHSSRQEGGNTCSLNNGNCA
HLCLATPAGAQCCCASHYTLNSDGQNCSAPTSFLLFSQKSGISRMVPGDPSPDIILPIHV
LRNVRAVSYDPVDRLVYWLDGRQNIRRASDDGTTSSVTVNANSQSADGQIHDLSLDPYSR
HIYWTCETTNTINIQKMSGQHVGVVLKDDANKPRAIVVSAEKGYMYFTTIQERSAKIEAA
SLDGTERECLFATGLFRPVALALDTAAGKLFWVDSDLKRIESSDLTGANRIVLQDSSILQ
PAGLTVLGDHLYWIDRQQQIIERVDKLTGDGRTRIQGRLASLTSIHAAESVARQHLENHP
CFRDNGGCSHICIAKLDGTPRCSCPVHLVLLQDLLQCGEPPTCSTEQFTCTTGEIDCIPL
AWRCDGFTECADSSDEENCPVCSPLQFKCDRGGCIDAHRRCNGEHDCADQSDERDCQSRC
GRHQCISKKQQCDTYSDCSDGSDELSCDADPPGHGAGSGPNAIVSVIAIILLVFVIGGAY
FFCQRVVCRCYKGQSGSFPHEYISGTPHVPLNFIAPSGSQRGTFQGISCGKSMMSSISLM
GSSSSGAPLYDRNHVTGASSSSSSSTKGAFYPQV
Download sequence
Identical sequences H2V5G6
31033.ENSTRUP00000044450 ENSTRUP00000044450 ENSTRUP00000044450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]