SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044801 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044801
Domain Number 1 Region: 623-1047
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.41e-111
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000447
Further Details:      
 
Domain Number 2 Region: 288-621
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 2.88e-83
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000281
Further Details:      
 
Domain Number 3 Region: 23-287
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.92e-71
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000309
Further Details:      
 
Domain Number 4 Region: 1194-1359
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.92e-49
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044801   Gene: ENSTRUG00000017475   Transcript: ENSTRUT00000044952
Sequence length 1656
Comment pep:known_by_projection scaffold:FUGU4:scaffold_137:465535:483261:1 gene:ENSTRUG00000017475 transcript:ENSTRUT00000044952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVIVLALAVALVVGSQDNFAPDFASDMTYEYDYEGKIMGGLPEKGLARAGLKIQAKVSI
RKANNAYYLKLSDAKIFEYNGIWPKDAFSLASKLSSELADQLMTPIKFEYTNGLVGKVSA
PAKVSATVLNICRGILNILHVTVKKTHNIYELQERGSQGMCKTHYIRVDKKEGAFTLIKT
RDLNHCQDRIYKDTGLAYAHRYPESEATKTKLKGMSTFSYEMKLTDQGSQIKNATTEEII
QFSPFNILNGAAQMEAKQKLILVNVLKTPLESIRGDYPTRGSLQYEFDTELLQTPVQLLK
TSSPVPQMVNILNHLVNFNMKMVHEDAPLKFIELIQMLRYAKYPEIESLWAQLKEKPDYR
TWILNAIPAIGTSTAVRFTKEKFIARELSVAETAQALIASVHLVTADLESLNLIKELCMH
ERVREIPFLHEMAMLGYGTAVSKYCVANPSCPVELLRPIHEILISAVQKVNAEEIILAVK
VLGNAGHPGSLKPLMKLLPCFSATDIKLPHRVHIEIVLALRNVAKKIPREVQNIAVKLFT
DKTTHAELRMAAAVVLFETKLPMGLVTSLATSLLKEENLQFASFVYSYMKAMTKSTTPDH
TSVAIACNVAMKILSPKYGRLSYRYSRAFYYDAYQNPWMMGAATSAFYVNEAATLLPKAV
LAKARTYLSGAYADVIEVGVRTDGIQEAILKMKDENSQRIDKITQIVKALSGWRASPSRK
PLASMYVKLFGQEIAFANIDKVVFDQLIEFGSQIPAYSRDALQSLLSGISTRVVKPMLVN
EIRHIFPTAVGLPMELSFYTAGVAAATVECRASVVPSLSREFKVSQLLDSDISIDASIIP
SVSLHTYAVMGVNTALIQAAMMTKAKVYTALPAKVQAKMNIMKGHFKFDFLPVEDVDKIA
SAFVETYAVARNVEDLAAARLTPVLPDEINVNSRGSSSSTKSTWMVKRKKKTLNETNLSK
SSEIVSDSQLVANQISVKSYQRKICKEYQPYGIKACTEIESRNAAFLRNCLLYSMIGRHG
VSVQVARDLFTSVAAPEIRNIEIEIQVGPKAAEKILRTVNLNEDEEVLADKTVLRKLQKI
LTPSLKNSSRRSSSSSSSSSSSSSRSRSRSSSRSSRSSSKCRSRRSSGSSSRHSSHSSRS
TSKIEISNRIKTHKFNKNHRKQKYKSQMADSSGSAASFEAVYEQNKFLGSSGVPSFAVVM
RAVKGKMVAGYQLAVYMDKPTNRIQMILADLDSENNWKLCADGIVLSEHRVVARIGYGAA
CNKYRATITAETGLVGPSPAGRLRVDWNEIPDALKRTLEKAMKSIPLSIECTFDKQRSKN
TANQVSVIIVAPTEKTLDIILKTPTYTFFNLDVPLPITLPINEIHGLAPFGDTVDELHVV
AAKAIAAQCNYAQNLLTTFNNIKYEPQMPPSCYQILVQDCTPELKFIVMLKNDNFEQKHI
NIKIADIDIDLFPKSGNIGVKVNGVEIPMENLPYYHPTVKIQIRQKGEGISVVAPSLGLS
EVYMDSKSWKVDVVDWMKGQTCGLCGKADGEIKQEFRMPNGHLTKNAVTYAHSWILAAES
CRDNSECRIKLDSVELEKQAVIYGQESRCFSVEPVLRCLPGCFPVKTTSVTVGFHCVAAD
SNVNKSEVLRGIQGKRVDLREKADAHLACSCTAQCV
Download sequence
Identical sequences H2V6G5
ENSTRUP00000044801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]