SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044804 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044804
Domain Number 1 Region: 623-1043
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.08e-113
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000389
Further Details:      
 
Domain Number 2 Region: 288-621
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.01e-83
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000281
Further Details:      
 
Domain Number 3 Region: 23-287
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.32e-71
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000309
Further Details:      
 
Domain Number 4 Region: 1250-1415
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.65e-44
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044804   Gene: ENSTRUG00000017475   Transcript: ENSTRUT00000044955
Sequence length 1715
Comment pep:known_by_projection scaffold:FUGU4:scaffold_137:465535:473551:1 gene:ENSTRUG00000017475 transcript:ENSTRUT00000044955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVIVLALAVALVVGSQDNFAPDFASDMTYEYDYEGKIMGGLPEKGLARAGLKIQAKVSI
RKANNAYYLKLSDAKIFEYNGIWPKDAFSLASKLSSELADQLMTPIKFEYTNGLVGKVSA
PAKVSATVLNICRGILNILHVTVKKTHNIYELQERGSQGMCKTHYIRVDKKEGAFTLIKT
RDLNHCQDRIYKDTGLAYAHRYPESEATKTKLKGMSTFSYEMKLTDQGSQIKNATTEEII
QFSPFNILNGAAQMEAKQKLILVNVLKTPLESIRGDYPTRGSLQYEFDTELLQTPVQLLK
TSSPVPQMVNILNHLVNFNMKMVHEDAPLKFIELIQMLRYAKYPEIESLWAQLKEKPDYR
TWILNAIPAIGTSTAVRFTKEKFIARELSVAETAQALIASVHLVTADLESLNLIKELCMH
ERVREIPFLHEMAMLGYGTAVSKYCVANPSCPVELLRPIHEILISAVQKVNAEEIILAVK
VLGNAGHPGSLKPLMKLLPCFSATDIKLPHRVHIEIVLALRNVAKKIPREVQNIAVKLFT
DKTTHAELRMAAAVVLFETKLPMGLVTSLATSLLKEENLQFASFVYSYMKAMTKSTTPDH
TSVAIACNVAMKILSPKYGRLSYRYSRAFYYDAYQNPWMMGAATSAFYVNEAATLLPKAV
LAKARTYLSGAYADVIEVGVRTDGIQEAILKMKDENSQRIDKITQIVKALSGWRASPSRK
PLASMYVKLFGQEIAFANIDKVVFDQLIEFGSQIPAYSRDALQSLLSGISTRVVKPMLVN
EIRHIFPTAVGLPMELSFYTAGVAAATVECRASVVPSLSREFKVSQLLDSDISIDASIIP
SVSLHTYAVMGVNTALIQAAMMTKAKVYTALPAKVQAKMNIMKGHFKFDFLPVEDVDKIA
SAFVETYAVARNVEDLAAARLTPVLPDEINVNSRGSSSSTKSTWMVKRKKKTLNETNLSK
SSEIVSDSQLVANQISVKSYQRKICKEYQPYGIKACTEIESRNAAFLRNCLLYSMIGRHG
VSVQVARVAAPEIRNIEIEIQVGPKAAEKILRTVNLNEDEEVLADKTVLRKLQKILTPSL
KNSSASDSDSSASKSTSATSHPRTRMIDANSPVDKKSKSSSSSRSCVRSRSPVSNASSRS
RRSSSSSSSSSSSSSRSRSRSSSRSSRSSSKCRSRRSSGSSSRHSSHSSRSTSKIEISNS
KQTDCFEQKFTNDHSHQQSHDSRRSKVWSSSSEAIANKDRYMADPKHLFLTVIIRAVRSD
QKLQGYQVTAYLDRQSRRVQIILANLDEQEKWGMYATAALLGNHKMMASLDWGKNSKQYQ
MVLTAESGSVATKSAIRVKMSWEKIPSSIKGRVRKLYRMVIHRSRDTGVQVKKAKNAPKQ
ITLSVAVGSKNRLSFQLVTPKRTFSKCDVKLPSYLPYFQTAEEIQVYHNNWLDKLFYILS
KSSAVECTVLKDKIITFNRGSFNTELPHSCAQVLVQDCSQELKFLVLLKKDYTQNQNQIN
VKIADLDIDMYNNNNAVQLKVNGVPFQISTQIYQHPTGHIHIRQRGEGITLHAPFYGLQE
IYFDMSALKVQVVDWMKGQTCGLCGKADGEVRQEFRMPNGRVANSAISYAHSWVESGKSC
RDPSGCLMKYESVKLEKQMFIEGQESKCFSVEPVLRCLPGCSPVRTTQANIGFHCVPADT
NLNYSEVQSSMFDKSVDVKETAEAHLACRCSMQCP
Download sequence
Identical sequences H2V6G8
ENSTRUP00000044804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]