SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046522 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046522
Domain Number 1 Region: 224-581
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.8e-57
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.013
Further Details:      
 
Domain Number 2 Region: 2-205
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.92e-22
Family Lipovitellin-phosvitin complex, superhelical domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000046522
Domain Number - Region: 838-915
Classification Level Classification E-value
Superfamily Serpins 0.027
Family Serpins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046522   Gene: ENSTRUG00000018181   Transcript: ENSTRUT00000046680
Sequence length 1716
Comment pep:known_by_projection scaffold:FUGU4:scaffold_94:809045:815882:-1 gene:ENSTRUG00000018181 transcript:ENSTRUT00000046680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVYALGMLPNPSPLMVRDMLAMAQFKQSKPIMYALSNVVRKLYQVKGVTPEITAVSEFI
SSLLGTDCAGDKDLTFLTLRVAGNMGDVLEAVNPAIKSTLVKCMRQPATTLSVQLSSIQA
FRRMSVTDEARNNLQRVCQYPKGGVQKRLAAYLILMKNPVDSDFDMVNKMLTQEQNEQIK
SFVSSHIYNIITSTDPEAQEVAKKFLDVLKDTELFTHSDYTSKSRNYKLDVAYEDMRAGI
QGSLFFDTSSKLPKEVLLETTLKAFGFDMDVWEIGMQGKGFEPTVEALFGKNGFFPHTLS
KVLYWTVDKVPQLQKWIKISERRKADDNLMREIVNNFNKVVKDLQNQEAPEAMAYLRIMG
NELGYIKGNELKFMADNALMYADIFMRIIPSKVMANLMSSTKNEIFVHYIFMDNKFVLPT
ASGLPLTFALSGIFTPGAKGGLNFAAQQKELSFMPSIGVEFVTQMGVQVPEFVVSTVEMH
TNMYHESALNAKVTMDNGQFKLSIPAPQGKTRIFSISFTFFLCNSNKVLVVGAGLAQVIP
HSEGDVTCRPLFSGVNYCTETLRKDTKGMSAAPYFPLNDISPSEEVTEYTATITYKLLNE
GKDGRQNVDSLKLALRAEGPSPTEATATMKYNRNRNVFTTQIVIPNIDVEAGIKVGMTDS
SSKGKSILFEISNKNVPQLSLIGRAKLQAMTDGMLQLQMLVPTLKTDATLTATMSKTDGL
TLEIKSDVKLPESSSVQAVTFKYGENQAEVMLMSNMNADTMVMNFYTEALRDWLMIYVDD
AMDQKVVSTDLKLRHIITKAVEASDIWMEKLTKECPYAEALRNKMTDMEMPALPENLFMN
FESTFKYHFNQDTLEIRIPLPLGGKSSMELRIPPVVTTPRIFVPQVGMEVASKEIQIPAF
TIPSEYDLTVPLMGMMEMSAKVNSNYYNWEATISAGNKTADSSSYEAKFNTVVESPIKIL
AFSAEGATKVTDTAEKMMKFTIDGSLKHMYINTGLNVLETVAVADNLMTTGKYKVQATSP
LGLDTSLEITTQLSLESSKLSGDINTEGHLTVGPMRATTAYVQTFSFEPLKRQAMVDSTL
RVNSESLTIGNKIKASYANNELMAEWDANMNSDFLKHTTKMSMNYRDVKLTFHSDCVTKA
AERILRNQVEFSASEGQVSLKIENQADDSVNRAFSLLTGSLNPSGLEINTDASVNLFSSL
ASHKTTLTISTNGLTTSCTTTAQHSPMTFENIFHGGVDASGASMSLSTKGAMKENKAELT
LEGKLASTEVYLNGIMNGNFDNMNTRNRLNLRLNEDGLLFSSNIVGSLNKMRTENINSLS
VTLRSFNLHSKTDNFLDMKNSYMHDITVAMERSTASVIVKNDLKIMDVNFVNDAQFKVMP
YTAELTGTTMGVFAEEQLKHTYEVKFVDMVLTAKCNTNGKLLGAHMTHATDMELDGLNIK
MNNLANLNSPYLRLDSTIKTQAAPFTLNIDALFNSDGAVNLYGQQSGDIYSKFLLKAEPL
LFTHSLEYRASTTHELEGRPTIKTNMNNKFNSLLSLQEQSVSVMMTSKVNEHAFDQEFSA
YNNAEKMGIEMMGAATTALFSDASENYAISGFVKYDKRSEGHFIQIPFVEYLPELIEHTK
VTMMRLMDYSLETLNDINTKYEISVKIQSKVSELKKIVNNFDFNLFFNDLRKFINSVENY
VVNLADKFPTDKVINVLKSIKEILNELSSFDYKQLI
Download sequence
Identical sequences H2VBD0
ENSTRUP00000046522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]