SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027048|ref|YP_008899166.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027048|ref|YP_008899166.1|
Domain Number 1 Region: 206-402
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.89e-62
Family B3/B4 domain of PheRS, PheT 0.0000087
Further Details:      
 
Domain Number 2 Region: 35-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.12e-48
Family Myf domain 0.0023
Further Details:      
 
Domain Number 3 Region: 493-707
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.21e-43
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000901
Further Details:      
 
Domain Number 4 Region: 718-819
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.71e-27
Family Anticodon-binding domain of PheRS 0.00039
Further Details:      
 
Domain Number 5 Region: 412-501
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000604
Family Domains B1 and B5 of PheRS-beta, PheT 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027048|ref|YP_008899166.1|
Sequence length 820
Comment phenylalanyl-tRNA synthetase beta subunit PheT [Thermosynechococcus sp. NK55]
Sequence
MRVSLRWLRELVAVDLDVAILADRLTMAGFEVEEIEDRRAWAEGVVVGRILACEPHPDAQ
KLRVCQVDVGQGEPRTIVCGAPNAAAGLYVPVALPGAYLAKIDLKIRPAKLRGVKSEGMI
CSLAELGLTKESEGIHTFTDAVTVGQDVRPLLGLDDVILHLSSTANRADALSMVGIAREV
AALTGAPLMLPTPKTIAPQKSGKAPVQLAIADPQACPAYCGTLITNVQIGPSPPWLQQRL
EAAGLRAINNVVDITNYILLKWGQPLHAFDWDRLQRVAAQTPVRVGVRFAKAGETLKTLD
GEERRLSLENLLITAGDVPVALAGVMGGEETEVHLGTQNVFLEAALFASPVIRRSARDQG
LRTEASARYERGVNPAELEAATAEAIALLREIAQGTVTYTTLADRRPPLERTLTLRLEQV
HRLLGAVVAEAEDSDEPAYLDAETVEALLRRLGFHLSRQETLEDELGVWSVTVPPYRFRD
IEREVDLIEEIARLYGYDRFEETLPAQAEVGALPLELTLLREVRAAFRGAGLTELMHYSW
VKGGQPNQVTVVNPLVAEFSALRTDLITGLVQAFRYNQEQGNPPLNGFEIGRVFGQDEEG
LWENDRLGGIIGGDPWQGKWVRRSQQPQPLTWYEAKGMLESVFQRFGLPVEYQSDRHDER
LHPGRTAVLSLQGERLGIFGQLHPQYAAALELPAAVYVFELDLEVLLSCLEERYQQIIFH
PFSTYPASDRDLAFFAPAALTVAELSRTIWKAAGGRDSLLESVELFDEYSGSGVPEGQRS
LAFRLSYRASDRTLTEAEVNELHQRIRDSLVEKYAVTLRS
Download sequence
Identical sequences V5V2N4
gi|571027048|ref|YP_008899166.1| WP_024124070.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]