SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027199|ref|YP_008899317.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027199|ref|YP_008899317.1|
Domain Number 1 Region: 125-290
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.05e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000329
Further Details:      
 
Domain Number 2 Region: 382-493
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.71e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000253
Further Details:      
 
Domain Number 3 Region: 3-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.45e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.00023
Further Details:      
 
Domain Number 4 Region: 262-394
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027199|ref|YP_008899317.1|
Sequence length 519
Comment assimilatory ferredoxin-nitrite reductase NirA [Thermosynechococcus sp. NK55]
Sequence
MSNKIEAIKKEKDGLAVKQELEKFAAIGWENIPEADRDVRLKWLGIFFRPVTPGKFMMRL
RVPNGILTSQQLRTLGEIVDRYGENGSGDITTRQNIQIRGLPIEDIPQVLEQLRACGLTS
VQSGMDNVRNLTGSPVAGIDAAELIDTRPLLMKLQAMITNNGQGNPEFSNLPRKFNIAIE
GGRDNSVHAEINDIAFVPAYRQGRLGFNVLVGGLLSARRCTAAVPLDAWVPPDEAVVYLC
RAILEIFRDHGLRGNRQKARLRWLIDEWGMEKFRAAVAAKLPFALLSAAPKDEIAWDKQD
HLGVHRQKQRRLNYVGLHVPVGRLYAPDFCELARIAQVYGQSEVRLTVEQNVIIPHVTDA
VLPSLLREPLLGKFRPEPPSLERALVSCTGAQFCNFALIETKNRALALARWLDQQLVLAQ
PVRIHWTGCPNSCGQPQVADIGLMGTKTRRNGETVDAVDLYMGGKVGKDAKLGTCIKKGI
PCDELPEVLRQLLIEQFGAKPRGLEVPPVPTLAVAMMVS
Download sequence
Identical sequences V5V2K7
WP_024124217.1.87165 gi|571027199|ref|YP_008899317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]