SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027200|ref|YP_008899318.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027200|ref|YP_008899318.1|
Domain Number 1 Region: 51-299
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.44e-27
Family Phosphate binding protein-like 0.039
Further Details:      
 
Domain Number 2 Region: 297-357
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000623
Family Chitinase insertion domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027200|ref|YP_008899318.1|
Sequence length 439
Comment ABC-type nitrate/nitrite uptake system substrate-binding protein NrtA [Thermosynechococcus sp. NK55]
Sequence
MANFSRRRFLITTAATAAATLISHACSNSQQSGDVAQPTTVAETPEVTGAKLGFIALTDA
APLIIAKEKGFFAKYGMPDVEVIKQASWGVTRDNLVLGSGGGGIDGAHILTPMPYLMTAG
TITGGKKVPMYILARLNTNGQGILLANTYKGLDVSTDSSPLKEAFAKARAERRTRNQEEN
IKVAVTFPGGTHDLWMRYWLAAGGIDPEKDVSVIVVPPPQMVANLKTGTMEAFCVGEPWP
LQTVNQKVGWGAVTTGELWKDHPEKSLALRADWVDKHPKATKALLMAVMEAQRWCDQDAN
KPEMAQILSKREWFKVPVEDILDRSLGKFDFGNGRTLEDKNLMQKYWRDNASYPYQSHEL
WFLTEDIRWGYLPAQTDTKALIQQVNREDLWREAAKAIGVPAAEIPTTTSRGVETFFDGV
AFDPQNPQAYLSSLSLKKV
Download sequence
Identical sequences V5V345
gi|571027200|ref|YP_008899318.1| WP_024124218.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]