SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027217|ref|YP_008899335.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027217|ref|YP_008899335.1|
Domain Number 1 Region: 32-494
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.31e-173
Family Type II DNA topoisomerase 0.000000000228
Further Details:      
 
Domain Number 2 Region: 505-714,742-845
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 2.75e-97
Family GyrA/ParC C-terminal domain-like 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027217|ref|YP_008899335.1|
Sequence length 853
Comment DNA gyrase subunit A GyrA [Thermosynechococcus sp. NK55]
Sequence
MSFAADSSRIIPTELREEISRSYLEYAMSVIVGRALPDARDGLKPVHRRILYAMHELGLT
SDRPFRKCARVVGEVLGKYHPHGDSAVYDALVRMAQDFSMRHPLIEGHGNFGSIDNDPPA
AMRYTECRLQALATEALLQDIEQETVDFVDNFDGSQQEPLVLPARIPQLLLNGTSGIAVG
MATNIPPHNLGELVDGLVALIHHPQISDRELMRYIPGPDFPTGGHILGQGGIEEAYTTGR
GSITLRAVATIETLEAPGRQPREAIIVTELPYQTNKAALMEKIAELVNEKKIEGIADLRD
ESDRDGIRVVIELKRDAYPRVVLNNLYKQTPLQVNFGANMLAIVNGEPQLLTLKRSLEVF
LRFREEAIARRTRYALRKAEERDHLLQGLLVALANLDAVIQLIRSASDTALARQQLMQTY
ALSEAQADAILQMQLRRLTALEAEKIEREHAELQRQIADYRDILAHRQRVLEIIEKEVTE
LKAKYATPRRSRIVQADGEISDTDLIANDKSVILVTQQGYIKRMPVDTFEAQSRDGRGRK
GAEIKEDDAVEHFFSCNDHDRILFFSDRGLVYALPAYQIPSGSRQARGTPIVQLLPIPRE
EKITSVIAVQEFSEDEYLVMLTRKGFIKKTPLAAFSNIRANGLIAISLEEGDQLRWVRRT
REEDTIIIGSRQGMAIHFRASHDQLRPLGRATRGVKSMSLRPGDELVGMDILPAAIANRF
AATPEDDRAESEDAEETVVHSEGPWVLVITTNGYGKRVPVQQFRLQNRAGMGITATKFKA
KSNEDQLAALRIVNAEDELMIVTSRGIIIRQKVMDISSQSRSATGVRLQRLDEEDAIVTA
AVLPPGSMEAAAD
Download sequence
Identical sequences V5V4Q3
gi|571027217|ref|YP_008899335.1| WP_024124235.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]