SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027294|ref|YP_008899412.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571027294|ref|YP_008899412.1|
Domain Number - Region: 161-179
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0732
Family FtsH protease domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027294|ref|YP_008899412.1|
Sequence length 372
Comment hypothetical protein NK55_02715 [Thermosynechococcus sp. NK55]
Sequence
MTRSALRRVAARGNLEAIQALLAAALAPQGIGVTVGQQPESLLLRLQCPTAVPAAIVLTL
LARELIHWPSYAHSSLLITASQDSNDLWEAVLDLTRPHELLRLAKGEHLRQQLPTPPRRE
EFGIPVQPLSTQDGQGIAAGLGLSLLLLASEQVTFLLSPLVTLVHELGHAVMAWLFGYPA
VPAFDFRYGGGVTLHGDRAGGLVLLIYAGLLALAYFYRQNRLTLICLGVLTLLYSLVAFS
PIHEMLFVAMGHGFELIFAVIFLYRALSGWGCRYPVERPLYSMLGFFIVFFNMRFAWQLQ
FNPVFREMYLMGKGGIDHDFVRLARDFFHTDLATVVGLYGFFVVLTPAIAFLLYRYRQLM
LYLLIRLFFSKG
Download sequence
Identical sequences V5V2W9
WP_024124310.1.87165 gi|571027294|ref|YP_008899412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]