SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027316|ref|YP_008899434.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027316|ref|YP_008899434.1|
Domain Number 1 Region: 9-402
Classification Level Classification E-value
Superfamily Clc chloride channel 5.23e-67
Family Clc chloride channel 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027316|ref|YP_008899434.1|
Sequence length 420
Comment chloride carrier/channel (CIC) family transporter [Thermosynechococcus sp. NK55]
Sequence
MARASCPYPRLLLYALIIGLLGGCVATAFYLGLKLGFALLWGTEPNQVSIGTWAHLYPYI
PLVTAFGGLLVGLSVKFFGAKGEIAAAIAELHHEGRFSYRFLPGMALASGLSLLFGSSAG
PESSMIDINGGLGTWLAARLHLSPDSTRILTLCGMAAGMGVFFESPLGATLFVLELPHRR
SLEFYEAILPALISAVAGFTLFRVITGTTIGGIYRFPTYDSLRPEDIGFAVLIGIIGAAV
GTLFVFLDRQIQRWLTPYRQYPLLLIVAVGFLIGLIALIHPITLFYGERQIEQVIQVVNR
YSIGILLRVAFFKLLALSLCLRGGFRGGVVFPLFFVGACVGMAVHQALPNTPLSVALAGM
MAAVTVVVTKTPLGLAIILTVISHTTMLPLITIATLTSYLLTLPIAWIPSQRSRRDPPDP
Download sequence
Identical sequences V5V3G5
WP_024124332.1.87165 gi|571027316|ref|YP_008899434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]