SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027323|ref|YP_008899441.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027323|ref|YP_008899441.1|
Domain Number 1 Region: 807-1033
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.75e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00014
Further Details:      
 
Domain Number 2 Region: 295-498
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.92e-31
Family Multidrug efflux transporter AcrB transmembrane domain 0.00022
Further Details:      
 
Domain Number 3 Region: 45-139
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.02e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0032
Further Details:      
 
Domain Number 4 Region: 140-186,272-330
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.28e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0061
Further Details:      
 
Domain Number 5 Region: 724-808
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000112
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.013
Further Details:      
 
Domain Number 6 Region: 188-269
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000051
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|571027323|ref|YP_008899441.1|
Domain Number - Region: 570-619
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0105
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027323|ref|YP_008899441.1|
Sequence length 1063
Comment RND-type export system permease component heavy metal efflux (HME) family Rnd3b [Thermosynechococcus sp. NK55]
Sequence
MTSPRFSFSGLAVTRHIGTLMLTLTVVVLAVFTLLRLQVDLLPGITYPRIGVRLNIPGVI
PSVAVEEVTKPLEEALSRTEGVVQVYSQTREGQVSIDLFFEPGGDVDQALNEVTAAFNRA
RSTLPDIIESPRLFKFDPSQLPVYEFALTSETLSGRELRVFADEDLERELSIVPGVAGVD
VSGGTTEEVRILVDLDRLQATGVGLNQILTALSDRNQDVSGGRIRGQSAEPLTRTVGRFR
NLSEIEDVVLTGTNGQRVYLRDVAQVVDGSAEQRVFVTLNGQPAVKISIFKQPAANTVEV
ADGIKRRLAALQAANLVPRDARIIPVLDESVYIRNALNNVITAGLTGTLLAAIAVLLFLG
SVRQTLIILLAIPLSTMAAILLMGLFNFSLNVFSLGGLALGVGIVVDNAIVMLETLAEID
PQHMIQEQYLEEVKRRSQGIESALVASTLTNLVAILPFLLLGGLIALLFNELILTISFAV
AASLLVALTVVPALASRLLGVRVQNRLRQVAFIRLFNEKFLWLRGRYEWALGQVLRARWL
VVGLAIALLGGGSWLLSQQIPQELLPRINTGQVNLSAIFAPGTPLPQSRRVMAAVDEVLM
AQPGTEAVFTTTGGALLGTNTIANPLRANSNIILRRGVKVDRYITVATQALDQLNLVGVR
LRLSPGQVRGIILTNSPVRGADLDVILRGNDEDTLSRFGRQVLRVLDEKATLVRFRPDAD
PPQPEIQILPDWERVGELGLNTLNLGQTIQTALTGFVPTRLQRGDRLVDIRVQLNSESIQ
NPADLATIPLFTANNHPLRLGDVARIEPSQAPAEIRRINRQQVFMLAGNLVEGASLSAAL
AETNAILRELEFPPGVSLMPSTAAQANQQLQQALGVLGSLAAFLVFVVMAVQYNSLLDPL
VIMFTIPLALAGGIWGLYLTRTAIGATVIVGAILLVGIVVNNAIIMVELANEIYQQQGCS
RSQAIRKAAPARLRPIMMTTITTVVGMFPLALGLGEGSEFLQPLGIVVFSGLAVATLLTL
FLIPCFYVILHGFERTTHRSLPAPLPAPAVPPTGASPEELQQH
Download sequence
Identical sequences V5V3E7
WP_024124339.1.87165 gi|571027323|ref|YP_008899441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]