SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027329|ref|YP_008899447.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027329|ref|YP_008899447.1|
Domain Number 1 Region: 6-142
Classification Level Classification E-value
Superfamily CheY-like 8.25e-42
Family CheY-related 0.00069
Further Details:      
 
Domain Number 2 Region: 177-388
Classification Level Classification E-value
Superfamily PP2C-like 0.0000523
Family PP2C-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027329|ref|YP_008899447.1|
Sequence length 391
Comment two component signal transduction system response regulator with spoIIE domain [Thermosynechococcus sp. NK55]
Sequence
MSGDRQPYQILVIDDDPTTRFLLRKILRDLGYQVSVASHGREGIAIATAEKPALIICDWM
MPELDGLEVCRHIKQDQELSRSFFILLTAKGELEDRIQGLDAGADEFLSKPIDPNELRAR
IQAGLRLYQLSQDLLKQKQLLEAELHEAADYVRSLLPAPQEAPCKINYYFLPSSQLGGDC
FDFCWVGDRYLVLHILDVSGHGLGAALPSVSVLNLLRSTTREQTSGTFDFLQPAQVLEAL
NNGFQMTAQHEKYFTIWYGVYDRQTRQLTYASGGHPPALLLTPEADQWRATLLKTPGIPI
GMFADMVFTQATIEVSPSAVLYLFSDGVYEFETTDNQVWGLEAFRELLIAAHTQNPVPPL
SQLISQVQRHAAPAAFGSDDVSLVQVAFSHP
Download sequence
Identical sequences V5V308
WP_024124345.1.87165 gi|571027329|ref|YP_008899447.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]