SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027334|ref|YP_008899452.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027334|ref|YP_008899452.1|
Domain Number 1 Region: 394-455
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000000000523
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0042
Further Details:      
 
Domain Number 2 Region: 459-561
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000000000915
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 340-393
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000837
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027334|ref|YP_008899452.1|
Sequence length 582
Comment small-conductance mechanosensitive channel [Thermosynechococcus sp. NK55]
Sequence
MINWHKQFWRWGAIAFLTFFLAILSPWPSLAQLPLPAINQTPATPLPPGVTRMGELEITD
VRFDGNTLFTIAAPTIRDRSKLGDVMPVELRAELIQSNLRRVLHSALEDDRRSPARVDIG
VARLHNALVISARIGQAERTTRLLTVTEADSNYHQLPPETLAQQWRDILQQQMNQAIQER
THAALIRQIQQAVLIFLKVGAGSFVILIVQRFLIRQRKHLQGQLDTATPQTAEPEWVLPL
LPHLRHHFFLKQRIKLISLVRYLLLWVQVALWLLGLAAILRLFPMTRGLSSQVYGLPILW
MVVWFGTGLLNQFADLAFDRIRVFWEQNNLLKFADTQRQTLRISTTIEVMRSLKTAVIYL
TRLVVILSSLGMPVSSILAVGGFLALAISLGSQNLVKDVINGLLIVWEDQYGIGDVVAIE
PYSGMVENLNLRITQLRNAEGHLITIPNSTITKVANLTRTWSRVNLELWVDIETNPDRLL
SLLNDVSTHFYAEPEWQLKMLERPEILGIDQITASGLLVRIWIKTQPGQQWAVGREFRRR
LLNLMAAEGIAVGRLHQQLHLVRDRNGKNGNNEKTYPFPLES
Download sequence
Identical sequences V5V314
WP_024124350.1.87165 gi|571027334|ref|YP_008899452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]