SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027336|ref|YP_008899454.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027336|ref|YP_008899454.1|
Domain Number 1 Region: 115-299,434-587
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.74e-108
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000303
Further Details:      
 
Domain Number 2 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 1.46e-34
Family GAD domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1-105
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.76e-32
Family Anticodon-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027336|ref|YP_008899454.1|
Sequence length 601
Comment aspartyl-tRNA synthetase AspS [Thermosynechococcus sp. NK55]
Sequence
MRTHYCGDVRLRDVGTTVTLYGWVDRRRDHGGVIFIDLRDRSGIVQIVSDPQRTPDSYPQ
ADRLRSEYVVKIVGRVSKRPADSVNPKLATGDIEIYADYIEVLNTVRQQLPFAISSTENE
QVREEVRLRYRYLDLRRERMARNLQLRHRVIQAMRRFLEDEAGFIEVETPILTRSTPEGA
RDYLVPSRVNPGEWFALPQSPQLFKQLLMVAGCDRYYQIARCFRDEDLRADRQPEFTQLD
MEMSFMDQEEILELNEALICHIFKTVKGIDLPRPFPRLSYQEAMDRYGTDKPDTRYGLEL
VDVSDILKDSGFKVFSGAIAQGGVVKILPIPNGNDRISNVRIKPGGDLFQEAATAGAKGL
AYIRVRNNGEIDTIGAIKDNLSPEQKATLLERTGAEPGHLLLFGAGDAATVNKTLDRLRQ
TIAREFDLIDPMATHLLWVVDFPMFEWNAEEKRLEALHHPFTAPHPDDLADLKTARAQAY
DLILNGHEVGGGSLRIYQPELQRQVFDIIGIDEATAQEKFGFLLEAFEFGTPPHGGIAYG
LDRLVMLLAGEDSIRDTIAFPKTQQARCLLTGAPSSVEPQQLKELHVTPAKLAKTTTQTK
A
Download sequence
Identical sequences V5V3I8
gi|571027336|ref|YP_008899454.1| WP_024124352.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]