SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027355|ref|YP_008899473.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027355|ref|YP_008899473.1|
Domain Number 1 Region: 519-944
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.67e-135
Family DNA polymerase I 0.00000000967
Further Details:      
 
Domain Number 2 Region: 4-160
Classification Level Classification E-value
Superfamily PIN domain-like 1.54e-45
Family 5' to 3' exonuclease catalytic domain 0.0000413
Further Details:      
 
Domain Number 3 Region: 335-517
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.98e-45
Family DnaQ-like 3'-5' exonuclease 0.0000777
Further Details:      
 
Domain Number 4 Region: 183-295
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 2.39e-29
Family 5' to 3' exonuclease, C-terminal subdomain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027355|ref|YP_008899473.1|
Sequence length 945
Comment DNA polymerase I PolA [Thermosynechococcus sp. NK55]
Sequence
MSAPNLLLIDGHSLAFRAYYAFSKGRDGGLRTSTGIPTSVCFGFLKSLLEILEQQQSDHV
AIAFDLGEPTFRHAADENYKAGRAETPEDFITDIANLQALLRALRLPLLSQPGYEADDVI
GTVAHRLRSQGWQVSIVSGDRDLFQLIDRKGQVQVLYLGNTLGQRKQGLEAFDALKVREK
MGVWPEQIVDYKALCGDASDRIPGIKGIGPKTAVQLLSQYPTLEDIYAHIHEIMPLSLRT
KLINGEADARHSRTLAQIVHDVPLELSLEELHLTPFDWPMLDHLLDQLEFRALRMQLQEW
HRRLGGILPDLETDSEETWFFAPTDTPPPLNVQLIETPEQLQWLISQLETCTDANHPVAW
DTETTALNPRDAALVGLGCCWGAAPDQVAYLPLGHKEGQNLPLQDTLTALRPILEGDRYP
KVLQNAKFDRLVLRFQGIQLRGVVFDTMLASYVINPEASHNLKDLCQRYLPLPAQSYRSL
VGKDQTLADLSPATVAQYCGLDVHTTYLLKEKLEADLTPRLRQLLLEVELPLEPILAEME
ATGIRIDSDYLRQLSQELEQQLAALQQQAWDAVGQPFNLASPKQLSELLFGTLGLDTKKT
HKTKLGYSTDAATLEKLRGDHPVIDLILSHRTLAKLKSTYVDVLPTLVRPDTGRVHTEFN
QAVTATGRLSSSNPNLQNIPIRTEFSRQIRRAFIPEPGWLLVTADYSQIELRILAHLSQE
PALVAAYQEGADVHRLTAQFLLEKTDISSSERRLGKIINFGVIYGMGPQRFAREAGVSVA
DAKVFIQRFYDRYPRVFDYLRHMERLALSQGYVETILGRRRYFAFESRELQSLRGKPVEV
LADVDPSKLKMSSYERGLLRAAANAPIQGSSADIIKCAMVKLAPLLPPEKARLLLQVHDE
LVLEMPPEAWEHLQTTIPEVMSTAVPLRVPLAVDIYAAANWLEAN
Download sequence
Identical sequences V5V3K0
WP_024124371.1.87165 gi|571027355|ref|YP_008899473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]