SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027440|ref|YP_008899558.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027440|ref|YP_008899558.1|
Domain Number 1 Region: 145-433
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.92e-83
Family NadC C-terminal domain-like 0.0000907
Further Details:      
 
Domain Number 2 Region: 11-144
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.53e-40
Family NadC N-terminal domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027440|ref|YP_008899558.1|
Sequence length 437
Comment nicotinate phosphoribosyltransferase PcnB [Thermosynechococcus sp. NK55]
Sequence
MTGFTLATSDYSLLTDLYQLTMVATYAGEDLAWTPASFELSVRRLPRGYTYLVAMGLAQV
LEYLQQLRFTPQQIDYLRGLAVFERAPAAFWELLSQSEFRGDVWAVPEGTVVFAQEPLLR
IDAPLWQGQWIETCLLNIVNYQTLVATRASRLRQLVGEEVDLLEFGTRRAFSPQASLWAA
RSALAAGFTATSNVLAAQQLGMVPVGTMAHSLVMAIATLKGTEQEAFTVFLRYYPEGALL
VDTYDSLAAIGTLADRQAAGEILVKAVRIDSGDLLSLSQKIRQLLPHVKIIASGDLDEGE
IRRLRAAGACIDAYGIGTKLVTGEPVNGVYKLVEINGQGVMKISSGKMTLPGRKQIYRRP
SGDCLALASEEQVWGKPLLEPVMREGCPLYPPESLMTIRDRHRASLAELPETLLDVTQPV
VYSPALAALIQQLRQRP
Download sequence
Identical sequences V5V3S7
gi|571027440|ref|YP_008899558.1| WP_024124455.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]