SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027501|ref|YP_008899619.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027501|ref|YP_008899619.1|
Domain Number 1 Region: 40-457
Classification Level Classification E-value
Superfamily ADC synthase 1.31e-97
Family ADC synthase 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027501|ref|YP_008899619.1|
Sequence length 458
Comment isochorismate synthase MenF [Thermosynechococcus sp. NK55]
Sequence
MPVSLPLTFDLSSESEFYTQVSAGIQAAQQANCQFLSLGIALPTVDPLMLLAGLMHVSGE
SEHFYLEQAGEIVAACGAVATSSVQGHQRFGELQRFSEHILSRVWAIAPAEPRMFCQFSF
WDHTGSNRGVLPRWQVIQRLDQVWLTLNCALETTTPHRLWQDGQLVQRAMAHILADPPPC
PPPLAIARPPLTEQYGQFISRVKHALKLLEEGDIEKLVLAAALTLEQPQGFNWLGTLQNL
RQQYTNSYIFSVGQQGQQVFLGASPERLVKIANGVLWADALAGSRPRGQTQQEDQNLRHG
LYHSPKERYEHQVIVEFLCQTLQRLGMTCEVPAKPRILELSHIQHLQTLIQAPLPQPIHI
LQVVAALHPTPAVAGYPAARAQHWLRQLEPFDRNGYAAPLGWVTPTGEGEFIVGIRSAHL
QDNHAHLFAGAGIVKGSHPEREWQEILWKFQTMISALA
Download sequence
Identical sequences V5V410
WP_024124515.1.87165 gi|571027501|ref|YP_008899619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]