SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027539|ref|YP_008899657.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027539|ref|YP_008899657.1|
Domain Number 1 Region: 103-296
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.71e-54
Family BC ATP-binding domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 3-99
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.12e-24
Family BC N-terminal domain-like 0.0088
Further Details:      
 
Domain Number 3 Region: 301-372
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000565
Family BC C-terminal domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027539|ref|YP_008899657.1|
Sequence length 378
Comment phosphoribosylaminoimidazole carboxylase ATPase subunit PurK [Thermosynechococcus sp. NK55]
Sequence
MDKITRVGVIGGGQLAWMLALAAKEMGLSLWVQTPAATDPAVAVADGVCYGAITDGATTA
RLAEHVDVITFENEFVDLEELQHFEQRGVCFYPRLATLAPLLNKYQQRCFLQALGIPVPE
FAYLGDRPPSLPCVIKACRHGYDGQGTFVITDQQAWQQFQQHWPEIPPQGFLVEAFVPYV
KELAIMAARSPQGEIALYPVVETQQVAAICRWVMAPAPIPPQVSEQIQQIARQILTALDG
VGIFGLEFFLTATGEVLVNEIAPRTHNSGHYTIDACVTSQFQQHLRAISGQPLGSPDMRV
TAAVMVNLLGLAEPQVDYGAKCEALAALPHAHLHWYGKSQTYAGRKLGHITVLLEDPGAA
MPIIEQIEDIWYSTPVVV
Download sequence
Identical sequences V5V3K8
gi|571027539|ref|YP_008899657.1| WP_024124552.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]