SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027557|ref|YP_008899675.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027557|ref|YP_008899675.1|
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily RbcX-like 1.7e-41
Family RbcX-like 0.00000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027557|ref|YP_008899675.1|
Sequence length 126
Comment rubisco chaperone RbcX [Thermosynechococcus sp. NK55]
Sequence
MDVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESVQDGERYLEAL
FRQQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRCQQLERMTQVSEANVEGS
NPETPE
Download sequence
Identical sequences V5V5Q7
WP_024124569.1.87165 gi|571027557|ref|YP_008899675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]