SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027568|ref|YP_008899686.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027568|ref|YP_008899686.1|
Domain Number 1 Region: 17-202
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-40
Family Phosphoglucomutase, first 3 domains 0.0018
Further Details:      
 
Domain Number 2 Region: 266-398
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.49e-29
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 3 Region: 399-490
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 7.06e-21
Family Phosphoglucomutase, C-terminal domain 0.0038
Further Details:      
 
Domain Number 4 Region: 173-278
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.88e-20
Family Phosphoglucomutase, first 3 domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027568|ref|YP_008899686.1|
Sequence length 492
Comment bifunctional phosphomannomutase / phosphoglucomutase [Thermosynechococcus sp. NK55]
Sequence
MVGSVLRLDQVLIPEDAPIRFGTDGWRGIIGAEFTFNRLLRAAKAAAAVLYQTYGDGRTP
RIIVGYDHRFLAEHFGTAVAQLLTSQGYEVWLSNCAAPTPAFSWAVKAEGAIGGLVITAS
HNPAIYAGLKVKGAFGGSVPTPVTQAIEAQLAQGEPPPVGEAKTDYQVFDPWPSYCAALR
THVDPSPIREAIATGKLRVCADVMHGVAAGGLERLLDWPIEEFRRDRDPLFGGGAPEPIG
RYLAATQEQLRQQPSATPTICLVFDGDADRLAVIDGEGVLYTAQEMIPILIDHLAQHSPY
RGAVIKSISSSDLVARVAAHHGLAVIETPIGFKYIGDRMLAGEAVLLGGEESGGIGYGHH
LPERDALLSALYLLQALVTSGLSVGEYYQQLQVTTNFYSAYDRVDLTLTSLAQRQKLEAL
LGEHPFTQILESPVSHWDTIDGYKFHLADGGWLLIRFSGTEPLLRLYCQGKTPEQVQRIL
QWASQWAVAVAG
Download sequence
Identical sequences V5V449
WP_024124580.1.87165 gi|571027568|ref|YP_008899686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]