SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027643|ref|YP_008899761.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027643|ref|YP_008899761.1|
Domain Number 1 Region: 305-501
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.75e-51
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 835-1024
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.26e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000521
Further Details:      
 
Domain Number 3 Region: 39-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.75e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00022
Further Details:      
 
Domain Number 4 Region: 567-665
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.71e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00042
Further Details:      
 
Domain Number 5 Region: 719-803
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 6.02e-22
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00079
Further Details:      
 
Domain Number 6 Region: 185-275
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.88e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00014
Further Details:      
 
Domain Number 7 Region: 147-184,277-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.32e-21
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.002
Further Details:      
 
Domain Number 8 Region: 672-718,805-854
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.1e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027643|ref|YP_008899761.1|
Sequence length 1044
Comment RND-type export system permease component hydrophobe/amphiphile (HAE1) family Rnd1b [Thermosynechococcus sp. NK55]
Sequence
MISNFFIKRPVFATVCSLLIILVGAIALPTLAIEYYPNVRPPTIQVSANYAGANAETVET
NVTTILETQINGVEGMDYIDSTSNSFGNSNITITFTEGYDENIAAVDVNNLVASVTSQLP
PEVINTGVNVSKSTNQIVLALALYPEEGYDYDATFISNYATLYVVQPLQRLKGVGKVQVF
GQRTYAMRIWLDPNRLASRGLTAQDVVRALSDQNVQVGAGIIGAPPAPEGQEFQISIQAQ
SRLASEEEFADIIIQRGEDGSVVRIRDVGRTELGAQNYNTNFQFDGRNAVGIGIYQLSSA
NALDIARAVEAEMAILAEKFPPGLKWSVGFSTTDAVQESIKEVVITLIVAIILVIAVIFL
FLQDWRATIIPSVTIPVSLIGTFAFMKAFGFSINSLTMFGLVLATGLVVDDAIVVVENVT
RLIEDEGMTPQEAASRSMAEVTGALIATSLVMMAVFIPVAFFPGVTGRLYQQFALTIVFA
IALSTFNALTLSPPLCALLLRRERPSMANFILFRWINRLIARTRRGYARSLNVIVRLKYW
VLAGFVALLGMTYWLFQIVPGGFVPQEDQGYFVTLVQSPQGVSLEYTSNIVFKTADAIAQ
NPAVEHTFAIGGFSFFGTGSDKGIIFTSLKPWSRRPTLDQLLPQFQKVVAGELGAVVFSS
NVPTINLGGSGLGGFDMQVMDQQGLGLETLASSVNELILKANNTPGFVAVNTPFAINAPQ
LNVTVDRTRALALGVSLKDIFNAMQIYLGSLYVNQFTIFARSYQVIVQADKQFRSNPDDI
NRIYVRSEQNALIPLSNLVKIEEVSAPPIIYHHNLFRSAEVTGQTVPPLSDRQAIMTMAS
LAEEVLPNGIGYSWTGLSLESVRSAGQAPLIFGLGLVFVFLVLSAQYESYIDPLIIILSV
PLAIMGALLAQWLRGLNNDVFCQIGLVMLIGLASKNAILIVEFANQIRESKGTTIVKSVI
HAAEERLRPILMTAISFILGIFPLVIATGSGAKSRHSLGTSVTGGMIAATFLSFFVVPII
YILIKEVVARLTKEKPEEATPRGS
Download sequence
Identical sequences V5V4C5
WP_024124650.1.87165 gi|571027643|ref|YP_008899761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]