SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027667|ref|YP_008899785.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571027667|ref|YP_008899785.1|
Domain Number - Region: 32-84
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0464
Family Duplicated SiR/NiR-like domains 1 and 3 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027667|ref|YP_008899785.1|
Sequence length 131
Comment hypothetical protein NK55_04750 [Thermosynechococcus sp. NK55]
Sequence
MKKNIQRWMVAIALGVGISGATIPPPVVAQTSGGLLTAEQMKKLNLSVEQKQAVLRLTLR
TNDRILKILDRDQQRIFRNAIKQGKSTGEAMNLVALRPDQKTQLSKVMQDTRVEMLTILT
PEQVKQLQASQ
Download sequence
Identical sequences V5V601
WP_024124674.1.87165 gi|571027667|ref|YP_008899785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]