SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027729|ref|YP_008899847.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027729|ref|YP_008899847.1|
Domain Number 1 Region: 6-234
Classification Level Classification E-value
Superfamily Ribosomal protein S2 6.8e-96
Family Ribosomal protein S2 0.000000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027729|ref|YP_008899847.1|
Sequence length 263
Comment 30S ribosomal protein S2 RpsB [Thermosynechococcus sp. NK55]
Sequence
MAVLSLAQMLEAGVHFGHQARRWNPRMAPYIFTVRNGVHIIDLVQTAQLVDEAYNYIRNA
AEKGKRFLFIGTKRQAAGIVEQEALRCGSYYVNQRWLGGMLTNWNTIKTRVDRLKELESM
EENGLIDLRPKQEASALRRELARLQKYLGGIKQMRRLPDVAIIVDVKREYNAVAECHKLG
IPIVALLDTNCDPTQVDIPIPANDDAIRSIKLIVGKLADAIYEGRHGQLEEPEANLADED
DDGMTASDDGDAEALDIPDDSDA
Download sequence
Identical sequences V5V436
WP_024124736.1.87165 gi|571027729|ref|YP_008899847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]