SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027747|ref|YP_008899865.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571027747|ref|YP_008899865.1|
Domain Number - Region: 277-505
Classification Level Classification E-value
Superfamily Porins 0.00176
Family Porin 0.079
Further Details:      
 
Domain Number - Region: 127-180
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0412
Family NadC N-terminal domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027747|ref|YP_008899865.1|
Sequence length 583
Comment carbohydrate-selective porin OprB family [Thermosynechococcus sp. NK55]
Sequence
MARSILIWLGLVLAPAWGMSATLAANQLQDVSHRGDRSASEFFDYKLQQATHAVKSPFQV
AQVPAVADLEAQAPRLPAPDQSLERQRTMPQVTSVNQLSDVSPTDWAYQALASLVEKYGC
IAGYPDGTFRGNRAATRYEMAAALNACLDVISDRFATKEDLATLRRLMDEFKAELATLRG
RVDRLEARTAQLEARQFATATKLRASVIFNVSDVLTGTRALPAPGRGPTIDDNTVATYRA
RLNFDTSFYGKDVLRVRLQAANMPNYNAVTLTNMARLGYDTNTAGQFAIDDLYYRTPLTN
RLFLAFDAAAGNFDKNVFTFNPLLQSDETGAISRFGRFNPLYRFGGGNSAGLTLRYTLLE
NKQRGTNLVLNLGYQAPNANNPTPNAPNTNGLIGGAYAALAQLDWRPTKNLALGFTYVRS
FGTGVAGGTGSNGFPGSADNPIGNNANAAADNFGFQFTYRLIPKFNIAGWVGYSNVYQVQ
NFAPPRPEAEVLNWAATFGVPDVWRKGDVLGLIVGQPPQTISVRNVGGAPPATFNSYHIE
GVYRIPISRNISITPGVIALVNPNSNSNNAPIVLGVIRTTFSF
Download sequence
Identical sequences V5V680
gi|571027747|ref|YP_008899865.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]