SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027788|ref|YP_008899906.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027788|ref|YP_008899906.1|
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.11e-63
Family G proteins 0.000000103
Further Details:      
 
Domain Number 2 Region: 308-408
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.3e-34
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 215-311
Classification Level Classification E-value
Superfamily Translation proteins 6.28e-31
Family Elongation factors 0.00000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027788|ref|YP_008899906.1|
Sequence length 409
Comment translation elongation factor Tu TufA [Thermosynechococcus sp. NK55]
Sequence
MARAKFERTKPHVNVGTIGHVDHGKTTLTAAITMVLAAQGKAQARKYDEIDAAPEEKARG
ITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGAMPQTKEHI
LLARQVGVPSIVVFLNKVDMVDDEELLELVELELRELLNEYEFPGDEVPIIRGSGLKALE
AMTANPKTQRGENEWVDKIYELMDAVDSYIPTPERDVDKPFLMAVEDVFSITGRGTVATG
RIERGRIKLNETVELVGLRETRTTTVTGIEMFKKSLEEGIAGDNAGLLLRGLKKEDVERG
MVIAKPGSITPHTKFEGEVYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTITSFTADDG
SAPEMVMPGDRIKMTVELIQPIAIEQGMRFAIREGGRTIGAGVVSKIIE
Download sequence
Identical sequences V5V4Q4
WP_024124794.1.87165 gi|571027788|ref|YP_008899906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]