SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027846|ref|YP_008899964.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027846|ref|YP_008899964.1|
Domain Number 1 Region: 80-358
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.99e-68
Family Alanine racemase-like, N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 467-571
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000732
Family Eukaryotic ODC-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027846|ref|YP_008899964.1|
Sequence length 644
Comment biosynthetic arginine decarboxylase SpeA [Thermosynechococcus sp. NK55]
Sequence
MAAVSPTMALTVTKTSNWTIEDSEQLYRIQGWGEPYFGINAAGHVTVSPKGDRGGSLDLY
ELVQALQQRNISLPLLLRFSDILEDRIERLNACFARAIARYGYQGAYKGVFPIKCNQQRH
IIEALVRFGQSHQFGLEAGSKPELLIALAMLNTPGALLICNGYKDRSYIETAILARRLGH
TPIIVLEQPEEVAEVIAVSQALGIEPIVGVRAKLSTQGVGRWGTSAGDRAKFGLTVPEIL
AAVEQLREARMLNSLQLLHFHIGSQISAISVIKDAIREAGQIYGELVRLGANMQYLDVGG
GLGVDYDGSKTNFHASKNYSMQNYASDVVAGIKDACRQRGIPDPILISESGRAIASHQSV
LIFNVLGVSEVPKMTPEPATDEEHLIIRNLYDTYQTIDENNYQEAYNDALQFKGEAISLF
NFGYLSLPERARAESLFWACCAKILGIARQQEYVPDDLEDLEKIMASIYYINLSVFQSVP
DSWAIDQLFPIMPIHRLDEEPTERGILADLTCDSDGKIDQFIDLRDVKSVLELHPFRPGE
PYYLGLFLNGAYQEIMGNLHNLFGDTNAVHIRLTPKGYEIEHLVRGDTMQEVLGYVQYQG
DVLLEKIRCRTEAALAEEQITLAEAQHLLENYERSLRSYTYLCS
Download sequence
Identical sequences V5V505
gi|571027846|ref|YP_008899964.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]