SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027863|ref|YP_008899981.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027863|ref|YP_008899981.1|
Domain Number 1 Region: 362-543
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.61e-63
Family Pyruvate oxidase and decarboxylase PP module 0.0000417
Further Details:      
 
Domain Number 2 Region: 7-181
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.53e-55
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000273
Further Details:      
 
Domain Number 3 Region: 186-355
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.12e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027863|ref|YP_008899981.1|
Sequence length 552
Comment TPP-dependent 2-oxoglutarate decarboxylase Kgd [Thermosynechococcus sp. NK55]
Sequence
MPAIAHPMNTAELLVKCLENEGVEYIFGLPGEENLDVLQALRRSQIEFITTRHEQGAAFM
ADVYGRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLD
LVAMFSPVTKWNAQIVRPSITPEIVRKAFKIAQNEKPGAVHIDVPENIAAMEAEGYPLKP
SSPEKTYASFQSILKAAELINTAENPLILVGNGAIRAQAAAALTHFAEKLNIPVANTFMG
KGVIPYQHPLALWTVGLQQRDYISCGFDHADLVIAIGYDLIEYSPKSWNPDGRLPIIHIA
ATPAEIDSSYIPVVEVVGDISDSLYEILKRAERQDKPTPYAVALRQAIVADYCQYAQDES
FPVKPQKLIYDLRQVMGPEDIVISDVGAHKMWIARHYHCDRPNTCLISNGFAAMGIAVPG
AIAAKLVCPQRQVVAVTGDGGFMMNCQELETALRIGTNFTTIIFNDGGYGLIEWKQQRYF
GESVYVHFGNPDFVKLAESMGLKGYRIEETADFIPTLKTALAQDVPTIIDVPVDYSENLR
FNQRLGELSCDT
Download sequence
Identical sequences V5V4Y3
gi|571027863|ref|YP_008899981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]