SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027868|ref|YP_008899986.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027868|ref|YP_008899986.1|
Domain Number 1 Region: 3-428
Classification Level Classification E-value
Superfamily L-aspartase-like 1.34e-132
Family L-aspartase/fumarase 0.00000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027868|ref|YP_008899986.1|
Sequence length 431
Comment adenylosuccinate lyase PurB [Thermosynechococcus sp. NK55]
Sequence
MIERYTLAPMGNLWTDAYKFKTWLDVEIAVCEAQADLGHIPAEAVAEIKAKAKFDPQRVQ
EIEAEVKHDVIAFLTNVNEHVGDAGRYIHLGLTSSDVLDTGLALQLVASLRLIQEQLEHL
IQAVRHRAQEHRYTVMVGRSHGIHAEPITFGFKLAGWLAELLRHRDRLCQLQRTVAVGKI
SGAVGTYANVDPRVEAIACQKLGLQPDTASTQVISRDRHADYVQTLALLGASLERFAVEI
RNLQRTDVLEVEEFFAKGQKGSSAMPHKRNPIRSERLTGLARVLRGNALAALENVALWHE
RDISHSAVERVILPDSSILTHFMLVEMTDLVQTLQVYPENMRRNMNCYGGVIFSQRVLLA
LVEKGLSREAAYALVQKHAHAAWNQPQGDFAANLKADPQIQRYLSPEELEACFNPEHHLR
HLEEIYQRLGI
Download sequence
Identical sequences V5V4Z9
gi|571027868|ref|YP_008899986.1| WP_024124868.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]