SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027871|ref|YP_008899989.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027871|ref|YP_008899989.1|
Domain Number 1 Region: 165-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.66e-73
Family Extended AAA-ATPase domain 0.0000000371
Further Details:      
 
Domain Number 2 Region: 420-622
Classification Level Classification E-value
Superfamily FtsH protease domain-like 5.75e-63
Family FtsH protease domain-like 0.00000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027871|ref|YP_008899989.1|
Sequence length 642
Comment ATP-dependent metalloprotease FtsH1 [Thermosynechococcus sp. NK55]
Sequence
MKYAQRLCQRLSQLALVVGLSLAPTNMGLAQSSNNNTVSYTQFLNALKAGEVRSVELYQE
QGLAKFRRKNQPEQSPPQEVRLFDRNPELVELLRQVSSRYDTTVRVVPSGNESALFSLIS
NLVLGFFLLILFLMILQRVSNAPGGPGQILNFGKSRARFQMEAQTGVTFGDVAGIEEAKE
ELQEVVTFLKNSEKFTSIGARIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV
EMFVGVGASRVRDLFRKAKENAPCLVFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEM
DGFEGNTGIIVIAATNRPDVLDAALLRPGRFDRQITVDLPSYKGRLQILQVHARNKKIAP
EVSLEAIARRTPGFSGAELANLLNEAAILTARRRKPAMTNAEIDDAIDRVTIGMTLTPLL
DSKKKWLIAYHEVGHALLMTLLKHADPLNKVTIIPRSGGVGGFAQQIFDEERVDSGLYTR
AWLLDEITILLGGRAAEVEIFGDAEVTAGASSDLRAVANLAREMVTRYGMSDLGHLALET
TGNEVFLGRDLMPRAEYSEAVAVQIDRQVREIVMHCYEIARKLIREHRGAVDKLVELLLD
KETIDGDEFRALVRQYTTLPVKEPPWKATATPVSFRQDAQPS
Download sequence
Identical sequences V5V546
WP_024124871.1.87165 gi|571027871|ref|YP_008899989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]