SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027909|ref|YP_008900027.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027909|ref|YP_008900027.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Formyltransferase 7.46e-64
Family Formyltransferase 0.00000155
Further Details:      
 
Domain Number 2 Region: 204-324
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 6.91e-23
Family Post formyltransferase domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027909|ref|YP_008900027.1|
Sequence length 331
Comment methionyl-tRNA formyltransferase Fmt [Thermosynechococcus sp. NK55]
Sequence
MNIVYFGTPEFALAPLQRLLATETYQVLGVVTQPDRRRGRGNQLSPSPVKALALRHRLPI
WQPPSLRRDPQLPEVLRSLAADVFVVVAYGQILPQSILEIPRYGCINIHGSLLPKYRGAA
PIQWALYHGEQETGVTTMLMDAGLDTGPMLLKRKVGIHLEDNAATLSAKLSEIGADLLLD
TLQQLPQLQAEPQNDAEATYAPLIQKRDYAIDWERSALALHNQVRAFYPYAYTQWQGTPL
KILQTWPLIPEVAAKLPEPLQSCVREPEASAAPGTVLALVKGWGPVVQTGKGGLLLSQVQ
LSGRKAQSGWDFVNGVRLAIATQFGILSSAL
Download sequence
Identical sequences V5V4P4
WP_024124909.1.87165 gi|571027909|ref|YP_008900027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]