SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571027940|ref|YP_008900058.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571027940|ref|YP_008900058.1|
Domain Number - Region: 68-177
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0173
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027940|ref|YP_008900058.1|
Sequence length 182
Comment hypothetical protein NK55_06195 [Thermosynechococcus sp. NK55]
Sequence
MNIRHLHRQLAIALFLPLGLTACTGLAYRLGRSWFNLSKDFGRAMMAIHTGSCLGEWFSC
VYMLLLSWAVVVLIVSGFRLINPRLLKRPLSSAKRNIKVRVIHQYGALFLLLPLLISAIT
GVMYHLSRYWLGLPKERVAILLQVHEGAYLGAGLKPLYVLLLGMALLLMFFTGWRMLRQR
PA
Download sequence
Identical sequences V5V588
WP_024124940.1.87165 gi|571027940|ref|YP_008900058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]