SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028004|ref|YP_008900124.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028004|ref|YP_008900124.1|
Domain Number 1 Region: 95-257
Classification Level Classification E-value
Superfamily alpha/beta knot 2.94e-44
Family SpoU-like RNA 2'-O ribose methyltransferase 0.00023
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily L30e-like 2e-22
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028004|ref|YP_008900124.1|
Sequence length 259
Comment tRNA/rRNA methyltransferase TrmH family [Thermosynechococcus sp. NK55]
Sequence
MIITSRQNQLVRSIRKLHHRKYRQGHLLLEGTHLIQEALASGYHLSVVCYTSAWQAKQSP
TFWQQLLHSSDRALEVSEEVLAALCTTTTPDGVVAVADYTPLPALPLQSLGLCLVTLQDP
GNLGAIIRTAAAVGVEGLLLTADCVDMTHPKVLRASAGQWFRLPMQTVTDGLATLKAYQA
QGWQIVVTLPTAPLIYWQGDFRQPTLLVMGNEGQGLPPAYQDLSFTALRIPQEPTVESLN
VAIATAVLLYEVYRQRWRD
Download sequence
Identical sequences V5V5H0
gi|571028004|ref|YP_008900124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]