SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028114|ref|YP_008900234.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028114|ref|YP_008900234.1|
Domain Number 1 Region: 20-255
Classification Level Classification E-value
Superfamily PLP-binding barrel 1e-69
Family Alanine racemase-like, N-terminal domain 0.000022
Further Details:      
 
Domain Number 2 Region: 249-382
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.99e-49
Family Alanine racemase 0.000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028114|ref|YP_008900234.1|
Sequence length 383
Comment alanine racemase Alr [Thermosynechococcus sp. NK55]
Sequence
MLSQEQLTSSHECERAWIEIDLAALAANTRSLRQWLAPTTELLAVVKADAYGHGALTVAQ
TVLAHGATWLGVATIPEGIALRQAGITAPILVLGSVNLPVQVQMMAEWQLQPTLSTPKQA
LIFSDYADRLREPLDVHLMIDTGMSRLGCPWQDAVGFVQFVQRLPHLRIQGIYSHFASAD
DPDASLMRQQQAYFEQVWEQISALGLGAVRRHMANSAATLANRSSHYDMVRIGLSLYGVY
PASHLRDVVPLRPVMQVRSRITLLKEIPAGTGVSYGHQFIAPQPMKIAVVGIGYADGVPR
LLSNKLEVLVQGKRVRQVGAITMDQLMIDVSDIDGLQEGDVVTLLGEDGGDCLTVETWAE
ALGTITWEILCGFKNRLPRIPVS
Download sequence
Identical sequences V5V5S4
gi|571028114|ref|YP_008900234.1| WP_024125110.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]