SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028183|ref|YP_008900303.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571028183|ref|YP_008900303.1|
Domain Number - Region: 13-70
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000134
Family Hypothetical protein TT1808 (TTHA1514) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028183|ref|YP_008900303.1|
Sequence length 91
Comment putative endonuclease DUF820 family [Thermosynechococcus sp. NK55]
Sequence
MFASAAYNRHDQLRGNRLNGVQAYLLWCPRDRQIHWFCLEAGEYPSLPADTEGIIGSRHF
PGLWLAPEALLVHELGTVLRGLQQGMATPEH
Download sequence
Identical sequences V5V5X9
gi|571028183|ref|YP_008900303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]