SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028204|ref|YP_008900324.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028204|ref|YP_008900324.1|
Domain Number 1 Region: 301-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.14e-48
Family Ribonuclease PH domain 1-like 0.00000654
Further Details:      
 
Domain Number 2 Region: 7-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-42
Family Ribonuclease PH domain 1-like 0.0000357
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-28
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 459-556
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.88e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 564-649
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.36e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 627-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-17
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 
Domain Number 7 Region: 237-328
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000497
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028204|ref|YP_008900324.1|
Sequence length 715
Comment polynucleotide phosphorylase/polyadenylase PnpA [Thermosynechococcus sp. NK55]
Sequence
MKGLEKIIPLDGRDVKVVLQKFAPQAAGSILISSGETAVLVTANRAAPREGIDFLPLVVD
YEERLYAAGRIPGGFLRREGRPPEKAILIGRLIDRPLRPLFPQWLRDDLQVVATTVSLDE
NVPPDVLAVTGASIAVLLAQIPFNGPMAAVRVGLVGDEFVINPTYKEIERGGLDLVVAGS
PDGVVMVEAGANELPEADMIEAIDFAYEVIQDLIQAQRDLLKELGIDIVRAEPPAIDPTL
ENFIYERAAQPVKAILKRFEKDKNVRDAALDEVQGAIAQEIAALPEDHPVAVAAAENPKA
LPTLFKAVTKKLMRQQIIEEGVRVDGRRLDEVRPIWCEVGVLPERVHGSALFNRGLTQVM
SVTTLGSPADAQALDDLHPEDSKRYLHHYNFPPYSVGEVKPLRSPGRREIGHGALAERAL
EPVLPPKEEFPYVIRVVSEVLSSDGSTSMGSVCGSTLSLMDAGVPIRKPVSGAAMGLIKE
GNEVRILTDIQGIEDFLGDMDFKVAGTDSGITALQMDMKITGLPVAVIKQAIEQARPARL
HILEKMLAVLDKPRPQLPPSAPRLLTLQIPPDMIGLVIGPGGKTVRGISEQYNVKVDISE
EGLVTITAPNETNAKQARAAIEGLTRKLNAGDVYLGKVTRIIPIGAFVEFLPGKEGMIHI
SQLAEYRVGKVEDEVKIGDEIVVKIREVDSKGRINLTRLGIHPDEAEAARSNSVV
Download sequence
Identical sequences V5V611
gi|571028204|ref|YP_008900324.1| WP_024125200.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]