SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028259|ref|YP_008900379.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028259|ref|YP_008900379.1|
Domain Number 1 Region: 172-434
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 4.32e-82
Family Creatinase/aminopeptidase 0.000000262
Further Details:      
 
Domain Number 2 Region: 3-171
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 7.15e-50
Family Creatinase/prolidase N-terminal domain 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571028259|ref|YP_008900379.1|
Sequence length 435
Comment Xaa-Pro aminopeptidase PepP [Thermosynechococcus sp. NK55]
Sequence
MKAEYQQRQQQFLEKLGTGVAVFCSAPRAIMHNDVDYNFRQDSNFYYLTGFNEPEAVAVF
APNHSEHRYVLFVQPKDLSQEIWTGARLGVDAAKEELGADAVYPIGELEEHLPRYLETGD
PLYYHFGHNERFNQLILKHYQRLLATLPKRGTGPRAIADPSILLAPMRQIKSAAELALIR
RAIAITVEAHQCARELAAPGRWEYEIQAEIEHVFRLRGGDGPAYPSIVASGPNACVLHYT
ENQRQMAAGDLLLIDAGCAYRYYNADITRTFPVSGQFTGEQKAIYDIVLAAQKAAIEQVR
PGNTYNQIHDAAVQVIVEGLVDLGLLRGEIETLINEGKENQTQKYRTFFMHGTGHWLGLD
VHDVGLYKHNKETWVTLQPGQVLTVEPGIYIHPEATPAEGQPEIGDRWRGIGVRIEDDVL
VTADGHEVLTAAVPK
Download sequence
Identical sequences V5V672
gi|571028259|ref|YP_008900379.1| WP_024125255.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]