SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028337|ref|YP_008900457.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028337|ref|YP_008900457.1|
Domain Number 1 Region: 7-49
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000141
Family Rho termination factor, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571028337|ref|YP_008900457.1|
Sequence length 412
Comment Rho termination factor-like protein [Thermosynechococcus sp. NK55]
Sequence
MPKDRPPLEEMTLRQLRRVASELQVSRYSRMRKDQLLAAIREKQAQANGSTTTISIQPVP
SSLESQEKVEAAKFDLGPTQDDVLLASVDEGLGDLPGGYGESRIVLMPRDPQWAYAYWDV
PNEHREELRRQGGQQLALRLYDATNINLDSQIPHSVQEYPCDELAREWYLPIPVSDRDYV
VEIGYRCADGRWLVLARSAPIHIPPAYPSDWVWDQFITVDWDMDLRGKTLFDLGAPLAGT
AEPNPIYEGIFAMAEGAEAQRVAGSLFGSMHQVPGAISQLPEMAISSYVFPSGVGLWAVP
TVSGLTMSGVGFSASAAPIRPRKFWLVADAELIVYGATEPDATVTIGGRPIKLNPDGTFR
FQMSFQDGLIDFPILAVAADGEQNRAIHMKFTRETPERRTNTKEEAVLEWLA
Download sequence
Identical sequences V5V5U8
gi|571028337|ref|YP_008900457.1| WP_024125331.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]