SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028367|ref|YP_008900487.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028367|ref|YP_008900487.1|
Domain Number 1 Region: 3-227,419-663
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.46e-148
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000413
Further Details:      
 
Domain Number 2 Region: 227-418
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.88e-55
Family ValRS/IleRS/LeuRS editing domain 0.00000202
Further Details:      
 
Domain Number 3 Region: 659-853
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.68e-38
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571028367|ref|YP_008900487.1|
Sequence length 855
Comment leucyl-tRNA synthetase LeuS [Thermosynechococcus sp. NK55]
Sequence
MDDRYDPQVIEAKWQQEWAARQLDRTDTDPQKPKFYALSMFPYPSGNLHMGHVRNYTITD
VIARCRRMQGYRVLHPMGWDAFGLPAENAAIERGIHPRLWTQQNIGQMRQELQRLGLAYD
WEREVTTCDPDYYRWTQWLFLEFFEAGLAYQKEAAVNWDPVDQTVLANEQVDSEGRSWRS
GALVERRLLKQWFLKITAYAEELLNDLEQLTGWPERVKLMQANWIGQSTGAYLEFPIVGS
NEKIGVFTTRPDTVYGVTYVVLAPEHPLTLKVTTSRRRKTVEAFIASVQQESELERTAGD
RPKRGVATGGKALNPFTGEAIPIWIADYVLYEYGTGAVMGVPAHDERDFQFAKAHKLPIR
QVIIPPDGKASARPKAAYTEPGRLINSGQFDGMDSTAAKVAITEYAAAQGWGRAQVQYRL
RDWLISRQRYWGVPIPIIHCPQCGPVPVPRSELPVLLPEDVEFTGRGPSPLAKLAAWRDV
PCPQCGGPAQRETDTMDTFIDSSWYYFRYADARNSEAPFDPAAIKDWLPVDQYVGGIEHA
ILHLLYSRFFTKVLRDRQLVHVSEPFQRLLTQGMVQGRTYKNPRTGKYIIPSRIPDLNQP
TDPDTGEALEVVYEKMSKSKYNGVAPGDVIQQYGADTARMFILFKAPPEKDLEWDDADVE
GQFRFLNRVWRLVQTFKAKGGRLGQPLPTTLTKAEKDLRRAIHTAIKEISEDIEGDYQLN
TAVAELMKLSNALSSADCYTSGVYSEGIQTLLTLLAPFAPHISEELWHQLGGTDSIHRQP
WPKADPTALVADEITLVIQVMGKTRGAIQVPAAASQAELEEAAKHSEIGQRYLAGKTIKK
VIVVPGKLVNFVLES
Download sequence
Identical sequences V5V5Z9
gi|571028367|ref|YP_008900487.1| WP_024125361.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]