SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028388|ref|YP_008900508.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571028388|ref|YP_008900508.1|
Domain Number - Region: 63-108
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 0.00334
Family Argininosuccinate synthetase, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571028388|ref|YP_008900508.1|
Sequence length 110
Comment photosystem II reaction center protein Psb28 [Thermosynechococcus sp. NK55]
Sequence
MAEIQFIRGVDEEVVPNVRLTRARDGSSGQAIFYFDNPKVVQEGNLEITGMYMVDEEGEI
VTRDVNAKFINGQPVAIEATYTMRSPQEWDRFIRFMDRYAASHGLGFQKS
Download sequence
Identical sequences V5V6J3
gi|571028388|ref|YP_008900508.1| WP_024125380.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]