SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028403|ref|YP_008900523.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028403|ref|YP_008900523.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 2.32e-53
Family Dimethylarginine dimethylaminohydrolase DDAH 0.038
Further Details:      
 
Weak hits

Sequence:  gi|571028403|ref|YP_008900523.1|
Domain Number - Region: 614-695
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00289
Family Pyruvate oxidase and decarboxylase, middle domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028403|ref|YP_008900523.1|
Sequence length 699
Comment L-arginine deiminase ArcA [Thermosynechococcus sp. NK55]
Sequence
MSSTLRFLMCPPTHYEVDYVINPWMEGNIHKSSRDRAQQQWQKLYEIIHARATVELIEPQ
PGWPDMVFTANAGLVLGDRVVLSRFYHPERQGEEPYFKAWFESQGYQVFELPKQVPFEGA
GDALLDREGRWLWTGYGFRSELDSHAYLAKWLDIEVLSLRLMDERFYHLDTCFCPLTDGY
LLYYPPAFDAYSNRLIELRVPADKRIAVQETDAVNFACNAVNIDRTVILNCASQELKSAL
AQRGFEVVETPLTEFLKAGGAAKCLTLRVSEPVREELHAPATIPNRVVHLEGHLLDSGLM
NRVLDTIVENGGSFQVLQFNLGEQRQSPSQADIRVMAPDAEVMDAIMAQLISLGAILPPS
EVCDANLETVTQAGVAPDDFYVTTIYPTEVRVGGEWIRVQNQRMDGAIVVRSTPEGTVAE
CRILRDLQVGDRVVVGVEGIRTVRKTESQRNNQEFTFMGSGVSSERRVELVVEQIAWELR
RIRDQGGKAIVVAGPVVIHTGGGEHLAKLIREGYVQGLLGGNAIAVHDMEQAIMGTSLGV
DMQRGVPVRGGHRHHLKVINTIRRCGSIANAVAQGILTSGVMYECVKNNVPFVLAGSIRD
DGPLPDTLMDLIVAQREYARLIRGANMILMLASMLHSIGVGNMTPAGVKLVCVDINPAVV
TKLADRGSVESVGVVTDVGLFLSLMVQQLERLHRPYTLA
Download sequence
Identical sequences V5V6K0
WP_024125395.1.87165 gi|571028403|ref|YP_008900523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]