SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028406|ref|YP_008900526.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028406|ref|YP_008900526.1|
Domain Number 1 Region: 76-421
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.3e-75
Family Extended AAA-ATPase domain 0.00000000872
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000105
Family ClpX chaperone zinc binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028406|ref|YP_008900526.1|
Sequence length 440
Comment ATP-dependent Clp protease ATP-binding subunit ClpX [Thermosynechococcus sp. NK55]
Sequence
MAKYDTHLKCSFCGKSQEQVRKLIAGPGVYICDECVELCNEILDEELATVPNVAAPRRES
TPSRSPRSTPRSRPLSQVPKPRQIKEFLDKHVVGQHEAKKILAVAVYNHYKRLSLLDSDQ
RGDDNVELQKSNILLIGPTGSGKTLLAQTLAKLLDVPFAVADATTLTEAGYVGEDVENIL
LRLLQNANMDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKILEGTIANV
PPQGGRKHPYQDCIQIDTTNILFICGGAFVGLEKTIEQRVGKKAMGFVRDGELLPKEKRS
ADILKELEPHDLVKYGMIPEFIGRIPVVAVLEPLDVAALAEILTQPQNALLKQYQKLMRM
DSVELRFEPAAVEAIAQEAYRRKTGARALRAIVEEIMLDVMYELPSRKDLRECTITPEMV
EKRSTAELLLHPSSLPTLSA
Download sequence
Identical sequences V5V6J2
WP_024125398.1.87165 gi|571028406|ref|YP_008900526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]